KEGG   Larimichthys crocea (large yellow croaker): 104938398
Entry
104938398         CDS       T04659                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00230  Purine metabolism
lco01100  Metabolic pathways
lco04020  Calcium signaling pathway
lco04114  Oocyte meiosis
lco04261  Adrenergic signaling in cardiomyocytes
lco04270  Vascular smooth muscle contraction
lco04371  Apelin signaling pathway
lco04540  Gap junction
lco04912  GnRH signaling pathway
lco04914  Progesterone-mediated oocyte maturation
lco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104938398
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104938398
   04020 Calcium signaling pathway
    104938398
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104938398
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104938398
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104938398
   04914 Progesterone-mediated oocyte maturation
    104938398
   04916 Melanogenesis
    104938398
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104938398
   04270 Vascular smooth muscle contraction
    104938398
Enzymes [BR:lco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104938398
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053 OPA3 DUF4400
Other DBs
NCBI-GeneID: 104938398
NCBI-ProteinID: XP_019118267
LinkDB
Position
XIII
AA seq 1119 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYVIVMCAVVYTTDKLASVLVASVGLAADII
LYLLCRFGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCCVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYTCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGERCD
YLRERGIETYLVVVPKGPVGKNGINGVKLSVTSSNGNSPLLINTTECNGSVNTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLEREIVQALKGKH
TNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCVVLLFTAAMEALIDPWLIANYITFAVG
EVLLLILTICSLAAIFPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTMADIMDMLSC
LPRVPDSGSPTAAPSSSRPGSGPGCWDNPKYYSYIAVLALMATTMLVQVSHMVKLTLMLL
ITVATGIVNIYSWRDIFDSYDMARFQDYRSYLVPSKFTMTIMIFIMMVSFYYFSRHVEKL
ARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIG
VMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMA
ASGVTPDVSNGYTYMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGL
NKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVRRG
PIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcctcgcaaccgagccttttcagagccggagtactctgcagagtattcggcagactgc
tcggtgacactgccctctgaccctgggcaggcagtggggcgaacgcatgaagtcacagtt
cggagctcaggatgctgcctctgcctgccaaggttcatgcgcctcacctttgcacccgag
tctctggagaacctttaccagacttatttcagacggcagagacatgaaaccctgctagtg
cttgttgtgttcgccgccctctttgacagctatgtcatcgttatgtgtgcggtggtctac
accactgacaagctggcttctgttttagtggcatcagtgggactggcagcagatattatt
ctatacttgctgtgtcgctttgggttgctcccagaccgcatctcgagacgggtggtgccc
tacgccctgtgggtgctcatagcagctcagatattctgctacctgggtttgaactatgct
cgcttccaccaggccagtgacacagtgggctggcaggctttcttcagcttctcctttttc
ctgacgctgcctctgagactgacacccatcgtgctcatcactactgtatcctgctgtgtc
cacaccctggttctgggtgtcactatcgcccagcagcagcaggaggacatccagggggca
gcactcggcagacagctgctggccaacattgtgatctatacttgtgccatcactgtgggt
gtcatgtcatactacatggccgacaggaagcatcggaaggcctttctggaggcaagacag
tcactggaggttaaactcaaccttgaggagcagagccagcaacaggaacgtctgctgctc
tccatccttccaaagcacatagctgatgagatgcttcaggacatgaagaaggagcccagt
cagaaagagatgcagcagttcaacaccatgtacatgtacaggcatgaaaacgtcagtatt
ttatttgcagacatcgtgggctttacccagctgtcgtcttcctgcagcgctcaggagctc
gtcaaactgctcaacgagctctttgctcgctttgacaaactggctgcaaaatatcatcag
ctgaggatcaagatcctaggagactgctactactgtatctgtgggctaccagactacagg
gaggaccacgctgcctgctccatcatgatgggtctggccatggtggaggccatctcgtat
gtccgagagaaaacccagacagatgttgacatgcgggttggagtgcacagtggtacagtc
ctggggggagtgctgggtcagaaacgctggcagtacgacgtctggtctacagacgtcact
gtggccaacaaaatggaggctggggggataccgggtcgtgtccacatctcacagagcacc
atggagtgtcttcatggtgagtttgatgtggagccagggaatgggggggagcgctgtgac
tacctgagggagcgcggtatcgagacctacctggtggttgttcctaaaggtcctgtggga
aagaatggcatcaatggtgtcaagctgtctgtgacctcttccaatggaaactccccactg
ctgatcaacaccacagagtgtaacgggagtgttaatacagcctgcaccacaccggaagaa
ccagaagaactggacacaagggtggtgaatccatcttttcctaacccccgcagaaggttg
cggctgcgggacttggctgaaagggtgatcgatgctcaggagaatgaacaggagctcaac
aaactgctcaatgaggctctgctggagagggagatagtccaagctctgaaggggaagcac
accaataggctctccctgaggtttgtggatccagaccttgagactcgttactcagtggag
aaggagaaacaaagtggagctgcattctgctgctcctgcgtggtcttgctcttcactgca
gctatggaggccctcatagacccctggctgattgcaaactacatcacgtttgcagtggga
gaagtcctgttgctcatcctgacaatctgttctctggccgccatcttccctcgagtcttt
cccaagaagctggtgtctttctccacttggatcgaccacacccgctgggctcgtaatacc
tgggccatggcagccattttcatcctcaccatggcggacatcatggatatgctgagttgt
ctgcctcgagtcccagactcaggcagccccacagctgctccctcctcctccagaccaggg
tctggccctggttgctgggacaaccccaaatattacagctacattgctgtgctggcactg
atggcaaccaccatgctggttcaggtcagtcacatggtcaagctgacactgatgctgctc
atcaccgtggccaccggcattgttaacatctacagctggagggacatatttgacagctac
gacatggcccggttccaggactacaggtcatacctggtgccctccaagttcacaatgaca
attatgatcttcattatgatggtcagcttctattatttctcccgacatgtggagaagctg
gcccgcaccctgttcctgtggaagattgaggtccatgaacagaaggagaaagtttatgag
atgagacgctggaatgaagcactggtgaccaacatgctgcccgaacatgttgcccgacac
ttcctgggttccaagaaaagggacgaggaactttacagccagtcctacgatgagattgga
gtcatgtttgcctcaatccccaacttctctgacttctacacagaggagagcatcaataat
ggagggatcgaatgcttacgcttcctcaatgagatcatctcagactttgacagtctgcta
gatgaacctcagttccgctgcatcacaaagatcaagaccatcggcagcacctacatggca
gcatcaggtgtcaccccagacgtcagcaatggctacacctacatgaagaaggaggagcag
tctgacagagagcgctggcagcacctggcagacctggcagactttgctctggccatgaag
gtcacactcatgaacatcaactaccagtcattcaacaacttcatgctccgcattggtctg
aataagggtggagtgttagcaggagtgatcggtgcccgaaaaccccactacgacatctgg
ggcaacactgtgaacgtggccagtcgcatggagtccacaggagtgatgggaaacatccag
gtggtggaggactgctacaacatcctgaaggagtacggcttccgctttgtgaggaggggg
cccatctttgtgaaggggaaaggggaactgctcacatattttctgaagggaagagacaaa
caaggctcatttatcaacggctcctctgtcactctgccacaccaggtggtggacagctaa

DBGET integrated database retrieval system