KEGG   Larimichthys crocea (large yellow croaker): 104938610Help
Entry
104938610         CDS       T04659                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04012  ErbB signaling pathway
lco04068  FoxO signaling pathway
lco04150  mTOR signaling pathway
lco04270  Vascular smooth muscle contraction
lco04510  Focal adhesion
lco04810  Regulation of actin cytoskeleton
lco04910  Insulin signaling pathway
lco04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104938610 (braf)
   04012 ErbB signaling pathway
    104938610 (braf)
   04068 FoxO signaling pathway
    104938610 (braf)
   04150 mTOR signaling pathway
    104938610 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104938610 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104938610 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104938610 (braf)
   04914 Progesterone-mediated oocyte maturation
    104938610 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104938610 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104938610 (braf)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104938610 (braf)
Protein kinases [BR:lco01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104938610 (braf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 104938610
NCBI-ProteinID: XP_010753328
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MAALSSAESPPPVFNGDTAEREPGRERGLVELGAGLDSSCTSEIPGGPQDEEIWNIKQMI
KLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGNGTDFSCSPS
PMPALLEVKMGGCGVRGGAQAFPSAPNTLAVLQTPTDASRANPRSPQKPIVRVFLPNKQR
TVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLLVSKFFEHHPFTQEEVSSEGTTPVSEACPSLPPSDSTGSICHPTVSPSKSIPIPPSF
RPNEEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLPRSDGGSTTGLSATPPAS
LPGSLTNVKVPQKSPCQQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGS
GSFGTVFKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQL
AIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLH
EDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIV
LYELMSGALPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERP
LFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFSA
FK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccgcccgtctttaacggagacaccgcggag
cgggagccgggcagagagcggggcctggtggagcttggtgccgggctggactcctcttgc
acgtcggagatcccgggaggtccgcaggatgaggagatctggaacatcaaacagatgata
aagttgacacaagaacacttagaggctcttctggacaagtttggaggagaacacaatcct
ccttccatttatctcgaggcctatgaggagtacactagtaaactggacgccctgcagcag
agggagcagcagctgctggaggctatgggcaacggtacagacttttcctgctctccttct
ccaatgccagcccttctggaggtcaagatgggaggttgtggggtcagaggtggggctcag
gcctttccctcagcccccaacaccttggctgtcctgcagacccccaccgacgccagccga
gccaaccctcgctcccctcagaagcccatcgtcagggttttcctgccaaacaaacagagg
acagtggtcccagcacgctgtgggatgactgtgagagactcgctgaagaaagctctgatg
atgcgaggcctcattccagagtgctgcgcagtctacaggatacaggacggagagaagaag
ccgattggctgggatacagacatctcctggctgacaggagaggagctgcatgtagaagtg
ttggagaatgtgccgctcaccacacacaactttgtgaggaagaccttcttcacgctggcc
ttctgtgacttctgcagaaagctgcttttccagggtttccgctgtcagacctgtggatac
aagtttcaccagcgctgcagcacagaggttcccctcatgtgtgtcaactatgaccagcta
gacttgttgcttgtgtccaagttctttgagcatcacccattcacccaagaggaggtctcc
tcagagggaaccacccctgtgtctgaggcctgtccgtcactccccccatctgactccacc
gggtctatatgccaccccactgtgtccccgtccaagtccatacccatccctcccagtttc
cggcccaacgaggaggaccaccggaaccagtttggccagcgggaccgttcgtcctccgcc
cccaatgtccatatcaataccatcgagcctgtcaacatcgatgacctgattcgagatcag
ggcttaccgaggtcagatggaggctccaccacagggctgtcagcgacacctcccgcctct
ttacccggctctctgaccaatgtcaaggttccacagaagtcaccatgccaacagagggag
cgcaagtcgtcgtcttcatctgaggaccgcaataagatgaaaactctgggcagaagagac
tccagtgacgactgggagatccccgaggggcagatcactctgggtcagaggataggttct
ggatcctttggaactgtcttcaagggaaagtggcatggtgatgtggcagtgaagatgttg
aacgtcactgctcccacaccacaacagcttcaggccttcaagaatgaagtgggagtcctc
aggaaaacacgtcatgtgaacatcctgctgttcatgggctacaccaccaagcctcagctg
gccatcgtgacccagtggtgtgaaggctccagtctgtaccaccacctgcacatcatcgag
accaagttcgagatgatcaagctgatcgacatcgcccggcagaccgctcagggcatggat
tacctgcatgccaaatcaatcatccacagagatctgaagagcaacaatattttcctccac
gaggatctgacggtgaagatcggtgattttggtctggctacagtcaagtcccgttggagt
ggctcgcaccagtttgaacagctgtctggctccatactgtggatggcaccagaggtgatc
aggctgcaggataagaatccctacagctttcagtcagacgtgtatgccttcggcatcgtg
ctgtacgagctgatgtcgggagcgctgccctactccaacatcaacaacagagaccagatc
atcttcatggtgggtcgaggttacctatctcctgacctcagcaaggtgcgcagcaactgt
ccgaaggccatgaagagactgatggccgactgcctgaagaagaagagagaggaacgacct
ctcttccctcagatcttggcctccatcgagctactggctcgctcgttacccaaaatccac
cgcagcgcctcagagccttcgttaaaccgagccggctttcagacggaggacttcagcttg
tacgcctgcgcctcacccaaaacccccatccaggccggcggctatggggagttttcagca
tttaagtaa

DBGET integrated database retrieval system