KEGG   Larimichthys crocea (large yellow croaker): 104938805
Entry
104938805         CDS       T04659                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X2
  KO
K18496  fibroblast growth factor 1
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104938805
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104938805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104938805
   00536 Glycosaminoglycan binding proteins [BR:lco00536]
    104938805
Cytokines and growth factors [BR:lco04052]
 Growth factors
  Growth factors (RTK binding)
   104938805
Glycosaminoglycan binding proteins [BR:lco00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   104938805
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 104938805
NCBI-ProteinID: XP_010753562
LinkDB
Position
I
AA seq 149 aa
MADEEAFVSEDQTVDGGLLMLSDYRRLTRLYCMNGGYHLQILPDGTVHGQRDDRDDHTVL
KLKAVDRGVVVIQGTEAGRYLAMSDEGRLYSSPTVTDECYFLEKLEENHYNTYQSQKHQE
KNWRSSYCAEENVRSIIDREQLSQLKLNL
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcggacgaggaggcgtttgtatccgaggatcagaccgtggacggcggcctgctgatg
ctgtcggactacaggcggctgactcggctgtactgcatgaacggcggatatcacctccag
atcctgcccgatggcaccgtgcatggccagagggatgacagggacgatcacactgtttta
aagctcaaagctgtggacagaggtgtggtggtcatccagggaacagaagccgggcgatat
ttggccatgagtgatgagggtcgcttgtacagctcacccacagtaacggatgaatgttat
ttcctggagaagttggaggagaaccactacaacacatatcaatctcagaaacatcaggag
aagaactggagatcttcttattgcgcagaagaaaatgtaaggagtatcatcgaccgggaa
caactgagccaactgaagctcaacctgtag

DBGET integrated database retrieval system