KEGG   Larimichthys crocea (large yellow croaker): 104939262
Entry
104939262         CDS       T04659                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04012  ErbB signaling pathway
lco04068  FoxO signaling pathway
lco04110  Cell cycle
lco04115  p53 signaling pathway
lco04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104939262
   04068 FoxO signaling pathway
    104939262
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104939262
   04115 p53 signaling pathway
    104939262
   04218 Cellular senescence
    104939262
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104939262
NCBI-ProteinID: XP_010754076
LinkDB
Position
VI
AA seq 168 aa
MCRIMSTHKRILRTLGNGPARRNLFGPVDREQLQADYQAILRKDLEEASTRWGFDFRLDK
PLESSEFQWEGIPSAKVPLLYRSCMFGLGQEKDQRVTEAAVTPKRRRVEPPPRREKENIP
CSPERCELDLEKTPEKGENTGLKRKQTNITDFYQAKRRVVWMPRKSGE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtgcagaattatgtcaactcacaagcggatcctgagaaccctgggaaatggccctgct
cgacgaaacctgttcggcccagtcgaccgagagcagcttcaggcggactaccaggccatc
ctgcggaaagacctggaggaggcttcgactcgttggggtttcgacttccgcttggacaaa
cctctggagagcagcgagttccagtgggagggaatccctagtgccaaggtgccactgctc
tacagatcctgtatgttcggtctggggcaggagaaagaccagagggtgaccgaggcagca
gttacgcccaagagaagaagggtggagccgccaccacggagggagaaggagaacatccca
tgttcgccagagagatgtgaactcgacctggagaaaacaccagagaagggagagaacaca
gggctgaagaggaagcagacaaacattacagatttctatcaggctaaaagaagagtagtt
tggatgccgcgcaaatccggcgagtga

DBGET integrated database retrieval system