KEGG   Larimichthys crocea (large yellow croaker): 104940038Help
Entry
104940038         CDS       T04659                                 

Gene name
kmt5a
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104940038 (kmt5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lco03036]
    104940038 (kmt5a)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104940038 (kmt5a)
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104940038 (kmt5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 104940038
NCBI-ProteinID: XP_010754899
LinkDB All DBs
Position
Un
AA seq 325 aa AA seqDB search
MSGVVCNTVLSCSASISPVHDEKTIKVTQEGRCSPICCQQIDAQRQGEGRRTNTISVTPK
DPKSEMESSYSQRSPCWPDEQQLYCAQTCLRSPAELSLPLGNSLSHAALHANNNNNNNGS
ALHSRQRRTVRLKVKGKKSTLRIAGGKNSQNRKVTDYYPIRRSSRKSKTELKCEEKKHID
DLITKGIEEGMEVQHIEGKGRAVFATRCFQKGEYVVEYHGDLLQITDAKKREAEYAQNPA
TGCYMYYFQYLCKTYCVDATKETGRMGRLINHSKTGNCQTKLHDINGVPHLILVASRDID
EGEELLYDYGDRSKASIAAHPWLKY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggtcgtatgcaacactgtcttaagctgctccgcgtccatatcaccggttcac
gatgaaaagacgatcaaggtgacacaggagggacggtgctctccgatatgctgccagcag
atcgatgctcagaggcagggagagggcaggagaacaaacaccatcagcgtcacaccaaaa
gacccaaagagtgagatggagagcagctacagccagcgttcgccctgctggccggatgaa
cagcagctctactgcgctcagacctgcctccgctcgcccgccgaactctccctgccgctc
ggcaacagcttatctcacgccgccctccacgccaacaacaacaacaacaacaacggcagc
gctctccacagccgccagaggcgaacggtccggctcaaggtcaaaggaaagaaatccacg
ctcagaattgccggcgggaaaaactcccaaaaccgaaaagttactgactactacccgata
agacgcagctcaagaaaaagtaaaacagagctcaagtgtgaagaaaagaagcacatcgat
gatctcatcacaaagggaatcgaagaaggaatggaggtgcaacatatagaaggaaaaggc
agagcggtgtttgccactcggtgtttccagaaaggcgagtacgtggtcgagtaccacgga
gacctgctgcagatcactgacgccaaaaagagggaggccgaatacgctcagaacccggca
accggctgctacatgtactacttccagtacctctgcaaaacttactgtgtggacgccact
aaagagactggtcgaatgggtaggttgataaatcacagcaaaaccggaaactgccaaacc
aaactccacgacatcaacggcgtccctcacctcatcctcgtcgcctcccgggacatcgac
gagggcgaggagttgctatacgactacggagaccgcagcaaagcctccatcgcggctcac
ccgtggctcaaatactga

DBGET integrated database retrieval system