KEGG   Larimichthys crocea (large yellow croaker): 109141199
Entry
109141199         CDS       T04659                                 

Definition
(RefSeq) putative transcription factor p65 homolog isoform X1
  KO
K04735  transcription factor p65
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04137  Mitophagy - animal
lco04210  Apoptosis
lco04218  Cellular senescence
lco04620  Toll-like receptor signaling pathway
lco04621  NOD-like receptor signaling pathway
lco04622  RIG-I-like receptor signaling pathway
lco04623  Cytosolic DNA-sensing pathway
lco04625  C-type lectin receptor signaling pathway
lco04920  Adipocytokine signaling pathway
lco05132  Salmonella infection
lco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109141199
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109141199
  09143 Cell growth and death
   04210 Apoptosis
    109141199
   04218 Cellular senescence
    109141199
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109141199
   04621 NOD-like receptor signaling pathway
    109141199
   04622 RIG-I-like receptor signaling pathway
    109141199
   04623 Cytosolic DNA-sensing pathway
    109141199
   04625 C-type lectin receptor signaling pathway
    109141199
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109141199
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109141199
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109141199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    109141199
Transcription factors [BR:lco03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109141199
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 109141199
NCBI-ProteinID: XP_019126229
LinkDB
Position
XIV
AA seq 624 aa
MADVYGWSMTTLNPVQTANPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHP
AIKVHNYTGPLRVRISLVTKNSPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLPTGELFPMEPVV
SQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIRVKMQLRRPSDREVSEPMDFQYLPAEPDEYRLS
DKRKRTGDMFVSLKLGPMLSSVSIPQDRRHISTARRTVTAKPPSMNAQAAAVVPPGASGA
KPQPSYSYNQPGQLFSVQTKVEASPISASQTWRNMDSLSLGNQPKATPVSSFTMGTTTST
TISTVSQELSTVNLSDLHEFFPTMSLGMVQEPAASQGSTASSQISSSFPLQGSQFRVDPP
VDDDIPEFPSFSEVQAPSTLENLNMDDFVDLLNPTLMSESGNGLVQASCQQAANSSSSTA
VQNSGACQNSSDPASNPGSTWMNYPNSIVNLLQNPEGMMDMAPNNNHQPHVLDDLDELMS
ADEDRLISILHSGNQARFVSGHPT
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggcggatgtgtacggatggagcatgaccacactgaacccagtccaaacagcaaacccc
ttcatagagatcatcgagcagccgaagcagaggggcatgaggttcaggtataaatgtgag
ggacgttcagccggcagcatccccggagagaagagcaacgacaccaccaagacccaccca
gccatcaaggtgcacaactacaccggtccactgcgcgtccgcatctcactggtgacgaag
aactccccgcacaagccgcacccccacgaactggtcgggaaagactgcaaacatggctac
tacgaggccgacctgcaggagaggagaatacacagttttcagaacctgggcatacagtgt
gttaagaagaaggatgtgaatgaggccatcacttgtaggctgcagaccaataacaacccc
ttcaacattcccgaggcgaaggtgtgggaggaggagtttgacctgaattcagttcggctt
tgcttccaggcctccatcactctgcctacaggggagctgtttcctatggagcccgtggta
tcgcagcccatctatgacaaccgcgccccaaacacagctgagctgaagatctgccgcgtc
aaccgcaactctggaagctgcaaaggaggggatgaaatctttctgctctgtgacaaagtg
caaaaagaggacattgaggtgcgtttcttccaggactcctgggagggtaagggcaccttc
tcccaggctgatgtccacagacaggtggccatcgtgttccgcacgccaccgtaccgtgac
actaacctctccgagcccattagagtgaagatgcagctccgtcggccctctgatcgcgag
gtcagtgagccgatggacttccagtacctgcctgctgaaccagatgaatacaggctgagt
gataagaggaagcgtacaggggacatgttcgttagcctgaagctggggcccatgctgtct
agtgtgtccattccacaagacagacgacacataagcacggcaaggagaacggttacagcc
aagcctccgtcaatgaacgcacaagctgcagctgtggtgccccctggtgccagtggagcg
aaaccccagccctcctactcatacaatcagccaggccagcttttctcagtgcagacaaag
gtggaggcctcccctatctctgcgagccaaacatggaggaacatggatagcttgagcctg
ggcaaccagcccaaagccactccagtgtccagtttcactatgggcaccaccacctctacc
accatttccactgtcagccaggaactctcaactgtcaacctgtcagaccttcatgaattc
ttccccaccatgtccttgggcatggtccaggagccagcagcatctcagggaagcacggcc
tcctcgcagatcagcagctccttccccctccagggctctcagttccgggtggacccaccg
gtcgatgatgatatcccagagttccctagcttttctgaagtccaagctcccagcacactg
gaaaacctaaacatggatgactttgtggaccttctgaaccccaccctcatgagcgagagc
ggaaacggcttggttcaagcctcatgccaacaagctgccaattcctcctcctctaccgct
gtccagaacagtggggcatgccagaactcttctgaccccgcaagtaacccaggaagcacc
tggatgaattaccccaacagcatcgtcaacttgctccagaatccagagggcatgatggat
atggcgcccaacaacaaccaccagccccacgtgctggatgacttggatgagctgatgtca
gctgacgaggatcgtcttatttctattcttcacagcggaaaccaagctaggtttgtgtca
ggacacccaacttaa

DBGET integrated database retrieval system