KEGG   Larimichthys crocea (large yellow croaker): 109142708Help
Entry
109142708         CDS       T04659                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
lco04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109142708
   00500 Starch and sucrose metabolism
    109142708
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109142708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    109142708
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109142708
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109142708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 109142708
NCBI-ProteinID: XP_019132873
UniProt: A0A0F8BND8
LinkDB All DBs
Position
Un
AA seq 112 aa AA seqDB search
MNEPSNFLDGSTNGCPSNSLENPPYTPGVLGGLLRAKTVCATAQQKQSIHYNVHSLYGLM
EAKASASAMKRITSKRPFVISRSTFPSQGMYSGHWLGDNRSQWKDLYTSIAG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaccatcgaatttcctggatggttctaccaatggctgtccatcaaacagtctt
gaaaatcctccttacacacccggtgtactaggaggtttgctgagagccaaaactgtgtgt
gccactgcacagcaaaagcagtccatacactataatgtgcacagtctctatggacttatg
gaagccaaggcatctgcaagcgctatgaaacggatcacgtcaaagagaccttttgtgatc
tctcgctccaccttcccaagtcaggggatgtactctggtcactggctgggagacaacagg
agccagtggaaagacctgtacacgtctatagcaggttag

DBGET integrated database retrieval system