KEGG   Larimichthys crocea (large yellow croaker): 109142984Help
Entry
109142984         CDS       T04659                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109142984
   00500 Starch and sucrose metabolism
    109142984
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109142984
    3.2.1.20  alpha-glucosidase
     109142984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 109142984
NCBI-ProteinID: XP_019134117
LinkDB All DBs
Position
Un
AA seq 758 aa AA seqDB search
MGFESMRKRHFSGLEVILMVMFALMSVAAITLLVLFVTGEPGTTTDGSTEAFVPQCPTIP
LAERVDCYPDAGASKERCDKRGCCWSPLDERNVPWCFFPNNHGYTVESVEKPNDYEMTAK
LKRMDSPSLFGADIKELSFHAEMQTNNRLRFKIFDAHKPRFEVPHEHVRSLNSAPSSPIS
DRLEMIKKPFGIIVRRRESKVVLFDTTMAPLVFEDQYLQLSARLPSHNIYGLGEHVHRQY
RHDTNWKTWPIFTRDAFPNGGTHNLYGHYPFFLCLEDASGKSFGVFLMNSNAMEVTLQPA
PAVTYRTIGGVLDFYILFGDTPEQVVQEFLELIGRPVIPPYWSLGFQLSRWDYGSLSEVK
KTVERNRAVDLPYDIQYTDIDYMEDKKDFTYDKVKFSELPDFANYLHEKGQRYILILDPA
VATSKRLGNAPYESYDRGTLKNAWVTESDGTTPLLGEVWPGETVFPDYTSQNCIDWWVDE
YERFSREIKHDALWIDMNEVANFKKGSNKGCAVNDLNYPPYTPKILDEVMYSKTLCMDAK
QAWGNHYDVHSLYGYSMVLATEKALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNAANW
NDIKWAIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAQGYRP
QDPAVFGPDSTLVASSKHYLQIRYTLLPYLYTLFYKAHTTGETVVRPVMHEFFSDSNTWT
VDRQFLWGKHLLITPVLDQVSQHTHTKKQTKQKIFQLP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgagtctatgaggaaaaggcatttctcagggctggaggttatcctaatggtc
atgttcgcattgatgtctgtggcagccatcactctcttagttctgtttgtcaccggagaa
ccagggaccactacagatggatctactgaagcatttgttcctcagtgtcccaccattcct
ctggctgaaagagtagactgttaccctgatgctggagcctcaaaggaacgatgtgataag
cgtggatgttgctggagcccactggatgagagaaatgtcccctggtgtttcttcccaaac
aaccatggatacacagtggagtcagtggagaaaccaaatgattatgaaatgacagccaaa
ctgaagagaatggactctccgtctttatttggggctgatataaaagagctgtcatttcac
gcagaaatgcagacaaacaatcgactccgatttaagatctttgatgcccacaagccgagg
ttcgaggtcccccatgagcatgtcagaagcctcaacagtgccccttccagccccatcagc
gacaggctagagatgataaaaaaaccctttggcattattgtgcgcaggagggagagcaaa
gtagtcctgtttgacacgacaatggctccactggtgtttgaagaccagtacctacagctg
tctgctaggcttccatcccataatatttacggtctgggagagcatgtgcatagacaatat
cgtcatgacacaaactggaaaacctggcccatcttcaccagagacgctttccctaatggg
ggaacccataacctctatggacattatcccttcttcctctgtctggaagatgcgagtgga
aagtcattcggggtatttctcatgaacagcaatgctatggaggtgaccttgcagcctgct
cctgctgtgacttacagaacgattggaggagtccttgacttctacattctctttggagac
acaccagagcaagtggtgcaggagttcctggagctcattggcaggcctgtcattcctccc
tactggtcacttggtttccagctttctcgttgggactacggcagcctgagtgaggtcaag
aaaacagtggagagaaaccgcgctgtggatctcccatatgatattcagtacactgacatc
gactacatggaggataagaaagatttcacgtatgacaaggtcaagttcagcgagctgcct
gactttgccaactatcttcatgagaagggacagagatacatcctcatcctggatcctgca
gtagctaccagtaagaggctcgggaatgctccgtatgagtcctatgaccgtgggactctg
aaaaacgcttgggtcactgaatccgatgggacaactccactgttaggagaggtgtggcca
ggagagactgtatttccagactacaccagccaaaattgcatcgactggtgggttgatgag
tacgagcgcttctccagggagatcaaacacgatgccctctggattgacatgaacgaggtg
gctaatttcaagaaaggttcaaataaaggctgtgccgtaaatgacctcaactacccaccc
tacactccaaagattctggatgaggtgatgtacagtaagacactatgtatggatgccaag
caggcctgggggaaccactatgatgtccacagtctgtatggctactctatggtgctggct
actgaaaaagctctgcagcgagtgtttggaggaaaccgtaccctgatgttgacccgctcc
tccttcccaggtgttggaaaatattcgggtcactggctgggggacaatgctgccaactgg
aacgacataaaatgggccattcctggcatgctagagtttggactctttggggttccctat
atcggagccgacatctgtggattctttgacgactccagtgaagagttatgtcgtcgctgg
atgcaggtgggagctttctaccccttcagccggaaccacaacgctcagggctacaggccc
caggatcctgctgtgtttggccccgactcaacgctggtggctagctctaagcattacctg
cagatacgttacacacttctgccttacctctacacactcttctacaaagcccacaccacg
ggggagactgttgtacgtcccgtcatgcacgagttcttctctgacagcaacacctggaca
gtggatcgccagttcctctggggaaaacacctgctcatcacaccagtactggaccaggtc
agccaacacacacacacaaaaaaacaaacaaaacaaaaaattttccagctgccttag

DBGET integrated database retrieval system