KEGG   Lysobacter capsici: LC55x_0305Help
Entry
LC55x_0305        CDS       T04162                                 

Gene name
sod-1
Definition
(GenBank) superoxide dismutase {Cu-Zn}
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lcp  Lysobacter capsici
Brite
Enzymes [BR:lcp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LC55x_0305 (sod-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALN83610
UniProt: A0A0S2FJB2
LinkDB All DBs
Position
319992..320564
Genome map
AA seq 190 aa AA seqDB search
MNHVLRTITIASFVGALAACGGQATKPTPPPAPPKPVSTAQSATVVLASASGSLVSGKLT
LRPMGDGVHLTGEIGGLTPNSVHAIHIHEKGDCSAADASSAGGHFNPAGQPHGQVGHGAH
HAGDMDNLNSDGEGVAKVDAHASGVTLGGGAANDVAGRAVIVHAVQDDYKSQPAGNAGAR
VACGVIKVVQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgtacttcgcacgatcacgatcgcctcattcgtcggcgcgttggccgcctgc
ggtggacaagccaccaagcccacgccgccgcccgcgccgcccaagccggtgtcgaccgcg
caatcggcgacggtggtgctcgcctcggcctccggcagcctggtcagcggcaagttgacc
ttgcgcccgatgggcgacggcgtgcatctcaccggcgagatcggcggactgacgcccaac
agcgtgcatgcgatccatatccacgagaagggcgactgcagcgcggccgacgcgagcagc
gccggcggccatttcaatccggctggccagccgcacggtcaggtaggtcacggcgcgcat
cacgccggcgacatggacaatctcaactccgatggcgaaggcgtggccaaggtcgatgcg
cacgccagcggcgtgaccctcggcggcggcgcggccaacgatgtcgccggtcgcgcggtg
atcgtgcatgccgtccaggacgattacaaaagccagcccgccggcaacgccggcgcgcgc
gtggcctgcggcgtgatcaaggtcgtgcagtga

DBGET integrated database retrieval system