KEGG   Lysobacter capsici: LC55x_3591Help
Entry
LC55x_3591        CDS       T04162                                 

Gene name
ace
Definition
(GenBank) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lcp  Lysobacter capsici
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcp01002]
    LC55x_3591 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcp04147]
    LC55x_3591 (ace)
   04090 CD molecules [BR:lcp04090]
    LC55x_3591 (ace)
Enzymes [BR:lcp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LC55x_3591 (ace)
Peptidases [BR:lcp01002]
 Metallo Peptidases
  Family M2
   LC55x_3591 (ace)
Exosome [BR:lcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC55x_3591 (ace)
CD molecules [BR:lcp04090]
 Proteins
  LC55x_3591 (ace)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 YkuD
Motif
Other DBs
NCBI-ProteinID: ALN86848
UniProt: A0A0S2FTT6
LinkDB All DBs
Position
4017091..4019106
Genome map
AA seq 671 aa AA seqDB search
MLALGVAAAVIGLSGCKKEPVPSSSTTTAPAAAPEGETADQFIARVNDEYKKMYPEMTAA
QWLSSTYINDDSQLLSAKANERYLTQLNSWIEQSKKFEGKQMSPATARAIQLLKIGTAMP
APKDPAKLAELTQIATRMEGMYGSGSYCSGPGDTDCRQLGDLEDVLRNSRDYDAQLDAWK
GWHTISKPMRKDYTRFVELVNEGAQNLGYADTGELWRSGYDMSPAELAAETDRLWGQVKP
LYEQLHCYTRSRLESKYGVDKGQTGGGMLPAHLLGNMWQQDWGNLWDVLAPYTEQQAGSL
DINGALARQYQQALDAQEAKSGGERSPLEQAQLEVDANLANAKQMTERAQDFYVSLGMPK
LPDSYWAKTQFIKPRDRDVVCHASAWDMNMGGDVRTKMCIKPNEEDFTTIYHELGHVYYY
LAYNKQPPLFQTGAHDGFHEAIGDTIVLAMTPKYLQSIGMVGNQQQSNEALINAQMRMAL
AKVSFLPFGLMIDRWRWGVFDGSIKPDAYNKAWWELKAKYQGVAPVQARGEEFFDAGAKY
HVPGNTPYTRYFLSHILQFQFYKSLCDAAGYKGPLYECSFYGNKAAGAKFEAMLSKGASQ
PWQQTMKELTGGEKMDATAVLEYFAPLQTWLKQQNEGKSCGWQASAAGAPAPVSPAKPAA
KADAKAKPAQG
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
ttgttggcgctcggcgtcgctgcggccgtgatcggcctgagcggctgcaagaaggaaccc
gtcccctcctcgagcaccaccaccgctccggccgccgcgcccgagggcgagaccgcggac
cagttcatcgcgcgcgtcaacgacgagtacaagaagatgtatccggagatgaccgccgcg
cagtggctgtcgtcgacctacatcaacgacgacagccagttgctgtcggccaaggccaac
gagcgctacctcacccagctcaacagctggatcgagcagtcgaagaagttcgaaggcaag
cagatgtcgccggccaccgcgcgcgcgatccagctgctcaagatcggcaccgcgatgccg
gcgccgaaggatccggccaagctcgccgagctgacccagatcgccacccgcatggaaggc
atgtacggctcgggcagctattgcagcggccctggcgacaccgactgccgtcagctcggc
gacctggaggacgtgctgcgcaacagccgcgactacgacgcccagctcgacgcctggaag
ggctggcatacgatttccaagccgatgcgcaaggactacacgcgcttcgtcgaactggtc
aacgaaggcgcgcagaacctcggctacgccgacaccggcgagctgtggcgctcgggctac
gacatgagcccggccgaactcgccgccgaaaccgatcgcctgtggggccaggtcaagccg
ctgtacgaacaactgcattgctacacccgctcgcgcctggaatccaagtacggcgtcgac
aagggccagaccggcggcggcatgctgccggcgcatctgctcggcaacatgtggcagcag
gactggggcaatctgtgggacgtgctcgcgccctacaccgagcagcaggccggcagcctc
gacatcaacggcgcactcgcgcgtcagtaccagcaggcgctcgatgcgcaggaagccaag
tccggcggcgagcgcagcccgctggaacaggcgcagctcgaggtcgacgccaacctggcc
aacgccaagcagatgaccgaacgcgcgcaggacttctacgtctcgctcggcatgcccaag
ctgcccgacagctattgggccaagacccagttcatcaagccgcgcgaccgcgacgtggtc
tgccacgccagcgcctgggacatgaacatgggcggcgacgtgcgcaccaagatgtgcatc
aagccgaacgaagaagacttcaccacgatctatcacgagctcggccatgtgtattactac
ctggcctacaacaagcagccgccgctgttccagaccggcgcgcacgacggtttccacgaa
gccatcggcgacaccatcgtgctggcgatgacgcccaagtacctgcagtcgatcggcatg
gtcggcaatcagcagcagagcaacgaagcgctgatcaacgcgcagatgcgcatggcgctg
gccaaggtctcgttcctgccgttcggcctgatgatcgaccgctggcgctggggcgtgttc
gacggctcgatcaagcccgatgcgtacaacaaggcatggtgggaactgaaggccaagtac
cagggcgtggcgccggtgcaggcgcgcggcgaggagttcttcgatgccggcgcgaagtac
cacgtgccgggcaataccccgtacacgcgttacttcctctcgcacatcctgcagttccag
ttctacaagtcgctgtgcgacgcggccggttacaagggtccgctatacgaatgcagcttc
tacggcaacaaggccgcgggcgcgaagttcgaggcgatgctgagcaagggcgcgagccag
ccgtggcagcagacgatgaaggaactgaccggcggcgagaagatggacgccacggcggtg
ctggaatacttcgcgccgctacagacctggctcaagcagcagaacgaaggcaagagctgc
ggctggcaggcgtccgccgcgggcgctccggcgccggtgtcgccggccaagccggcggcg
aaggccgatgccaaggcgaaacctgcccagggttaa

DBGET integrated database retrieval system