KEGG   Lysobacter capsici: LC55x_4276Help
Entry
LC55x_4276        CDS       T04162                                 

Gene name
ftsI
Definition
(GenBank) essential cell division FtsI; penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
lcp  Lysobacter capsici
Pathway
lcp00550  Peptidoglycan biosynthesis
lcp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LC55x_4276 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LC55x_4276 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lcp01011]
    LC55x_4276 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcp03036]
    LC55x_4276 (ftsI)
Enzymes [BR:lcp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LC55x_4276 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:lcp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LC55x_4276 (ftsI)
Chromosome and associated proteins [BR:lcp03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LC55x_4276 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALN87526
UniProt: A0A0S2FVD3
LinkDB All DBs
Position
complement(4747809..4749794)
Genome map
AA seq 661 aa AA seqDB search
MSGRKNKRPGRSGPLDRVLGERGNRGGGFDRLVENLGEGFARLREDRARAGNKPRGRSAQ
FNLRNRLILVGGTLGLCAVALLGRALDLQVIHNDFYRQQGDARSLREIPIPTSRGMITDR
NGEPLAVSTPVESIWGNPKELAKSPERLPALAKALGVAPDELTRKLSQRSGKEFMYLKRR
INPDEAKRILAYKIPGVFSQREFRRFYPQGEAMSHVLGFTNIDDRGQEGLELAFDHELRG
KPGVKRVIRDGAGRIVENVDLVQTAEPGKDITLTLDRRIQYLTYRELRRALIDTGASSAS
AVVLDIETGEVLAMANLPTYNPNLLGAGNRDTHRNRAITDVVEPGSTMKPITVAAALNAG
TVKPSTLVHTEPGWMPNGRYRITDTHNNGTLTVTGVITKSSNVGAAKLALPLPNDYYYKF
IQGFGYGRKPNSGFPGESSGLLAPPSRWSGTTKATMSYGYGLSATPMQIAMAYAAMANGG
KLIQPTFVKGQRNEPQQVLDPAVAGEIMHMMQTVTEPGGTAKQAAILGYHVAGKTGTTRK
FSATGGYSKKYVSLFAGVVPVEKPRFSMVVVVSEPDPTKKGYYGGSVSGPVFRNVMDGAL
RLMDVAPDDIETWLAVQAAAEAKRLKQNGGKPSGPVLPAATHEAAPPPPIAAGALAPGGV
R
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcgcaagaacaagcggcccggccgcagcggtccgctcgatcgcgtgctcggc
gagcgcggcaatcgcggcggcggcttcgatcgcctggtcgaaaacctcggcgaaggcttc
gcgcgcctgcgcgaggaccgcgcgcgcgccggcaacaagccgcgcggccgcagcgcccag
ttcaacctgcgcaaccggctgatcctggtcggcggcacgctgggcctgtgcgcggtcgcg
ctgctcggccgcgcgctcgacctgcaggtgatccacaacgatttctatcgccagcagggc
gacgcgcgctcgctgcgcgaaatcccgatcccgacctcgcgcggcatgatcaccgaccgc
aacggcgaaccgctggcggtgtccacgccggtcgagtcgatctggggcaatccgaaggaa
ctggccaagagccccgagcgcctgccggccttggccaaggccctgggcgtggcgccggac
gaactgacccgcaagctgtcgcagcgttcgggcaaggagttcatgtacctcaagcgccgg
atcaatccggacgaggccaagcggatcctcgcctacaagatccccggcgtgttctcgcag
cgcgaattccgtcgcttctacccgcagggcgaggcgatgtcgcacgtgttgggcttcacc
aacatcgacgaccgcggccaggaaggcctggagctcgcgttcgaccacgaactgcgcggc
aagcccggggtcaagcgggtgatccgcgacggcgccggccgcatcgtcgagaacgtcgat
ctggtccagaccgccgagccgggcaaggacatcacgctgaccttggatcgccgcatccag
tacctgacctaccgcgagctgcgccgcgcgctgatcgacaccggcgcgagcagcgcctcg
gcggtggtgctcgacatcgagaccggcgaagtgctggcgatggccaacctgccgacctac
aacccgaacctgctgggcgccggcaatcgcgacacccaccgcaaccgcgcgatcaccgac
gtggtcgagccgggttcgacgatgaagccgatcaccgtcgccgccgcgctcaacgccggc
acggtcaagccctcgaccctggtgcataccgagccgggctggatgcccaatggccggtat
cgcatcaccgacacgcataacaacggcaccctgaccgtcaccggcgtgatcaccaagagt
tccaacgtcggcgcggccaagctcgcgctgccgctgccgaacgactactactacaagttc
atccaggggttcggttacggccgcaagcccaacagcggtttcccgggcgagtcctcgggc
ctgctcgcgccgccgtcgcgctggagcggcacgaccaaggcgaccatgtcctacggctac
ggcctgtcggccacgccgatgcagatcgcgatggcctacgcggcgatggccaacggcggc
aagctgatccagccgaccttcgtcaagggccagcgcaacgagccgcagcaggtgctcgac
ccggccgtggccggcgaaatcatgcacatgatgcagaccgtgaccgagccgggcggcacc
gccaagcaggccgcgatcctgggctatcacgtcgccggcaagaccggcaccacgcgcaag
ttcagcgcgaccggcggctattcgaagaagtacgtgtcgctgttcgccggcgtggtgccg
gtggagaagccgcgcttttcgatggtggtggtggtcagcgaacccgatccgaccaagaag
ggttactacggcggttcggtgtccggcccggtgttccgcaacgtcatggacggcgcgttg
cgcttgatggacgtggcgcccgacgacatcgaaacctggctcgcggtgcaggccgcggcc
gaggccaagcgactcaagcaaaacggcggcaagccgagcggaccggtgctgccggcggcg
acccacgaagccgcgccgccgccgccgatcgcggccggcgcgctggccccgggaggcgtg
cgatga

DBGET integrated database retrieval system