KEGG   Lucilia cuprina (Australian sheep blowfly): 111674541
Entry
111674541         CDS       T06013                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00230  Purine metabolism
lcq01100  Metabolic pathways
lcq04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111674541
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111674541
Enzymes [BR:lcq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111674541
SSDB
Motif
Pfam: Guanylate_cyc AC_N Tetraspanin
Other DBs
NCBI-GeneID: 111674541
NCBI-ProteinID: XP_023290936
LinkDB
Position
Unknown
AA seq 1131 aa
MSETKLNNCNNIENGVSSLTSINKIKTKDENNESSEGPTVTLPHSVLNNLFTTFYVNQRR
EALKWFLLAYLCFSIYTLGIPAEQSIQNRTCYIIFDIIAVSSWLLMFAASKYERFKLKRP
FYIAILISSAPIVIWTCFILHFITYSFVQQVPISARELLGWAILFNFLVPVSLPVPLYYT
GCFMCFITFFGYYALIYLSSRDDPMFNEMLLANMVLVSAALIIGLLYYDMNAAKQRRAFL
EAKKSLEVKMIIEDQSAEQERLLLSVLPKHVAEKMRQDLGSTSSEPFKKIYMSRHENVSI
LYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDER
PDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVE
LANKMESSGKAGRVHISDKTLAYLSGEFEVEPAYGEKREEALRIAGLKTYFIKKVLKPFA
SPNAKKINETQNGNNDDNDDTLDEELLAESQEDKINNTQAETEEVCDKATLFKEELRNVL
RDRDYYAHIDQDTDCLLKFKLKEFEEDYTAYREPFSSLPLISALIVQSMDIVYSFLILPR
SPLHFVNIAAPLVPIFMLVFISIAESFPKYLPDFFVSISKRYNDFTCVRELTAIIIVLTI
GFSNVIDEYFFVAYIKSEHIVSESVFNKTQSEEDFLVAEPMIDATPDPLDNVMYPSYLSN
FCVLILIATTVIAQLTHFVKILLLTLITGLHWYFNIYVLNDLYALEDDLAFNPIVSTSHI
MSAALVFITISLAFWARHMDREDRVIFKWKLLVTEQKERADDMRKRNEALVYNVLPVHVA
EHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFD
ALLELPQFQDIIKIKTIGSTYMAASGINLNRDIKPGDPITKRWAHLALLVEFALELKKTL
QDINEQSFNHFVLKMGVNHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTE
ETCNILQEFGYSFLQRGLVSVKGKGQLMTYYLRVSLIDDIPIQQGMIGNIVNPTLESEVH
LKLDETDADIKTPLLNIKTNANSKSASPIKDCANDEMTTEEDALITTEETM
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgtctgaaacaaaattaaacaattgcaataatattgaaaatggtgtgtcgtccttaact
tccatcaataaaataaaaactaaagatgaaaataatgagtcctcggaaggacccaccgtt
acattgccccactccgttttaaataatttatttacaacattttatgtcaatcaaaggcgt
gaagctcttaaatggttcctcctcgcatatctttgctttagtatttatacactgggcata
ccggcggaacagtcgattcagaatagaacatgttacattatattcgatataatagcagtt
agcagttggttgcttatgtttgcggccagtaaatatgagagattcaaattaaaaaggccc
ttttatatagccatcttaataagcagtgctccaatagttatatggacatgttttatatta
cattttataacatattcattcgtccaacaagtaccaatatccgcaagagaactcttggga
tgggccattttatttaattttctggtaccagtaagtttacccgttcctttatactacact
ggatgttttatgtgttttataacctttttcggttattatgccctcatctatttgtcgtca
cgtgatgatcccatgttcaacgaaatgttgctggcaaacatggttttggtttcggcggct
ttaattattggtctgttgtactatgacatgaatgctgccaaacaaagacgggcatttttg
gaggccaaaaaaagtctagaggtgaaaatgattatcgaagatcaatcagcagaacaagaa
cgtttgctattgtcggtattgccaaagcatgtggccgaaaaaatgcgtcaagatttgggt
tcaacgagttctgaaccctttaaaaaaatctacatgagtcgtcatgagaatgttagtatt
ttatatgcagatatagtggggtttaccgccatatcatctacatacagtgctcaggacttg
gttaagatgttaaatgagttatttgcccgttttgatagattagcagagaaatatcaacaa
ctacgtataaaaattctaggtgattgttattattgcattagtggagcaccagacgaaaga
ccagatcatgctgtgctttgtgtacacatgggtttgtcgatggtaaaggctataaaatat
gtgcagcaaaaggccaattcacctgtggacatgcgagttggtatacatacgggtgctgtt
ttagccggaatattgggacaacgtcagtggcaatttgatgtatattcaaaggatgttgaa
ttagctaataaaatggaatcaagcggaaaggcgggtcgtgttcatatatctgacaaaact
ttggcatatttaagtggggaatttgaagtggaaccagcatatggagagaaacgtgaggaa
gccttacgtatagctggcctcaaaacttattttataaaaaaagttctgaagccttttgcc
tcccccaatgccaagaaaatcaacgaaacacagaacggcaacaacgatgacaatgacgat
actttggatgaggaactattggctgaaagtcaagaggataaaattaataatacacaagcg
gaaacggaagaagtttgtgataaagccaccttatttaaagaggaactacgtaatgtttta
cgtgatcgtgactattatgcacacattgatcaagataccgattgtttgttgaagttcaaa
cttaaagaatttgaagaagactatacagcctatcgggagcctttctcttcattaccactt
atatctgctttaatagtacaatctatggatattgtttattcatttttaatattgcccaga
tcacccttacattttgttaatatagccgcccctttagtaccaatattcatgttagttttt
ataagtatagcagaaagttttcccaaatatttgccggatttctttgtcagcattagtaaa
cgttacaatgattttacttgtgtaagagaactgaccgccattattatagtccttaccata
ggctttagtaatgtaatcgatgagtatttctttgtcgcctatataaaatctgaacatatt
gtgagtgagagtgtttttaataaaacccaaagtgaggaagattttctggtggccgaaccc
atgattgatgctacacccgatcctttggataatgttatgtatccctcctatttaagcaat
ttttgtgttttaatactaattgccacaactgtaattgcacagctaacacattttgtaaaa
attctcttactaactctaataacaggtttacactggtattttaatatttatgtccttaac
gatttatatgcattggaagatgatttggccttcaatccaattgtatcaaccagtcatatt
atgtctgctgctttggtatttataaccatatctttggctttctgggcccgacatatggat
cgtgaagatcgtgtcatatttaaatggaaattattggttaccgagcaaaaagaacgggct
gatgatatgcgcaaacgtaatgaggcattagtttataatgttctgcccgtacatgtagcc
gaacattttatgaagaatacaaaacgttcacatgatgatctctattcacaaagttatgca
gaagtgggtgtattatttgccagcatgccaaatttttcagatttttattctgaggaaact
gttaataatcaaggtttagaatgtttacgatttctcaatgaagttatatccgattttgat
gcacttttggaacttccacaattccaggatattattaagataaaaactataggttccact
tatatggcagctagtggtattaatttaaatcgtgatattaagccaggcgatcctataacc
aaaagatgggctcatttggctttattggtggagtttgctttagagttaaagaagacatta
caggacataaatgaacagtcatttaatcattttgttttgaaaatgggagtaaatcatgga
cccataacagcaggtgttataggtgccagaaagccacattatgatatatggggaaatacg
gtaaatgtggcgtctagaatggaaagcacaggaaaagcaggagctatacaagtcaccgag
gaaacgtgtaatatcttacaagaatttggttattcctttttgcaaaggggtttggtgagc
gtcaaaggaaagggacaattaatgacctattatttaagagtaagtttgatagatgatata
cccatacagcaaggcatgattggcaatattgtcaatcctacactagagagtgaagtacat
cttaaactcgatgaaacagatgcagatattaaaactcctctattgaatatcaaaacaaat
gccaactcaaagtcagccagtccaattaaggattgtgcaaatgatgaaatgactacggaa
gaagatgctttaattactactgaagaaacaatgtaa

DBGET integrated database retrieval system