KEGG   Lucilia cuprina (Australian sheep blowfly): 111675210
Entry
111675210         CDS       T06013                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111675210
   04215 Apoptosis - multiple species
    111675210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcq01002]
    111675210
Enzymes [BR:lcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     111675210
Peptidases and inhibitors [BR:lcq01002]
 Cysteine peptidases
  Family C14: caspase family
   111675210
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-GeneID: 111675210
NCBI-ProteinID: XP_023291704
LinkDB
Position
Unknown
AA seq 355 aa
MTDECISTTVEYITSATLKMNNNSSHQQQQQRDVYDGSVDDEDDTVGSHGLGQRNSFDRP
DALGMGCEESSNNPSAVHSTNGKPISVSEIKCMVARMPTERNAMEYNMNHKKRGLAIIFN
HEFFDIPSLENRKGTNVDCEKLKKTFNSLDFEVSIYKDCKLREVFEHIDKAASQDHSEHD
CIAVAILTHGEQGYLYAKDVMYKLDTIWHYFSARDCPTLAGKPKLFFIQACRGDRLDPGI
KLQKTETDGETSSDMSYRIPIHADFLIAYSTIPGFYSWRNTSNGSWFIQSLVEELNNYGK
KYDLLTLLTFVNRRVAMDYESCVPSRPIMDQQKQIPCITSMLTRILRFTDKPKQN
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgacagatgaatgcatatcgacaacggtggagtacataacaagtgctactttaaaaatg
aacaacaattcctcgcaccaacaacaacaacaacgggatgtctatgatggatctgttgat
gacgaagacgataccgttggcagtcacggtcttggtcaacgcaacagctttgatcgacct
gatgctttgggtatgggctgtgaagaaagttccaataatccatcagcagtacattccaca
aatggcaaacctatctcagtttcagagataaaatgtatggtggctcgtatgccaactgaa
cgcaatgccatggaatacaatatgaaccataagaaacgtggtttagctataatctttaat
catgaattttttgatataccatcattggagaatcgtaaaggcactaatgttgattgtgag
aaattaaagaagacatttaatagtctagattttgaagtatcaatatataaggattgtaaa
ttacgggaagtttttgaacatatcgataaggctgcttcacaggatcatagtgaacacgat
tgtattgcagttgcaatattaacacatggtgaacagggttatttatacgccaaagatgtc
atgtacaaattagatactatttggcattatttctcagccagagattgtccaacactggct
ggtaaaccgaaattattttttatacaagcctgccgtggtgatcgtttagatccaggtatt
aaactacaaaagactgaaacagatggtgagacatcatctgatatgagttatcgtatacca
atacatgctgatttcctaatagcatactcaacaataccaggtttctactcctggcgcaat
acttcaaatggttcatggtttatacagtctctggtcgaggaattaaataattatggcaaa
aaatatgatttactcacactgttaacatttgttaatcgtcgtgtggccatggattatgaa
tcgtgtgtaccatcgcgtcccataatggatcaacaaaagcaaataccttgcattacatca
atgttaacacgcattttacgttttaccgataaacctaaacagaattaa

DBGET integrated database retrieval system