KEGG   Lucilia cuprina (Australian sheep blowfly): 111675226
Entry
111675226         CDS       T06013                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111675226
   04215 Apoptosis - multiple species
    111675226
SSDB
Motif
Pfam: Collagen_bind_2
Other DBs
NCBI-GeneID: 111675226
NCBI-ProteinID: XP_023291721
LinkDB
Position
Unknown
AA seq 70 aa
MAVAFYIPDQATLLRKARQQEQQILAMREAHWRHVASVVYDALRQYLEATPSLLNRAKTN
SNKKVKPTKK
NT seq 213 nt   +upstreamnt  +downstreamnt
atggctgtagcattctatatacccgatcaagccaccttattgcgtaaggcccgtcaacag
gagcaacaaatcttagccatgcgagaggctcattggcgtcatgtggcctcggtggtctat
gatgccctaaggcaatacttggaggccacaccttctctactcaaccgcgccaaaactaac
agcaacaaaaaagtgaaacccactaaaaagtaa

DBGET integrated database retrieval system