KEGG   Lucilia cuprina (Australian sheep blowfly): 111675231
Entry
111675231         CDS       T06013                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111675231
   04215 Apoptosis - multiple species
    111675231
SSDB
Other DBs
NCBI-GeneID: 111675231
NCBI-ProteinID: XP_023291726
LinkDB
Position
Unknown
AA seq 210 aa
MAIAYFIPDQAKLLAGQRQSRATTNSSSSRSSSSPQTTSSRLTHNNNNNTPASETAPVNS
NVNRGYGTTINITVPTFNNTPQEPLGCWDFLTQVFCHALRFYHESSQLQPTVIQISVNFN
SQTATTTSSATTTADSTATTTATATTPATTSTQSVTFKGARQVCKTPPANPTPINRSSWQ
HATTKDHTNFNKWTTGVSRTVMAVKWFLSS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggctatagcttattttataccagatcaagccaaattattggcgggccaacgtcaatcg
agagcaactactaattccagttcctccagaagctctagcagcccacaaacaacttcctct
agattaacgcataacaacaacaacaatactccagccagtgaaacggcccctgttaattct
aatgttaatagaggttatggaaccaccattaatataacagtgcctacttttaacaacacc
cctcaggaacctttgggatgttgggattttctaacacaagttttttgtcatgccttgaga
ttttaccatgaatcatcgcaactacagccgacggtcatacaaatatcggtgaatttcaat
tcacaaacagcaacaacgaccagttcagcaacaaccacagcagactctacggcaaccaca
acagcgacggccacaacaccagcaactactagtactcaaagtgtaacatttaagggtgct
agacaggtatgtaaaacaccaccagcaaacccaacacccatcaatcgctcttcttggcag
catgccacaacaaaagaccacactaattttaataaatggacaacaggcgtttcaagaact
gtaatggcggtgaaatggtttttgtccagctaa

DBGET integrated database retrieval system