KEGG   Lucilia cuprina (Australian sheep blowfly): 111675834
Entry
111675834         CDS       T06013                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04013  MAPK signaling pathway - fly
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
lcq04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111675834
   04391 Hippo signaling pathway - fly
    111675834
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111675834
   04215 Apoptosis - multiple species
    111675834
SSDB
Motif
Pfam: TNFR_c6 PhoR Trp_oprn_chp Comm DUF4482 C6_DPF PspB LapA_dom Lectin_N
Other DBs
NCBI-GeneID: 111675834
NCBI-ProteinID: XP_023292441
LinkDB
Position
Unknown
AA seq 381 aa
MNNSYTPAHLTNLKITPLVTNNSSSRTQFDTTATNTNEPCSIQSRLESTNQCSTQDQEEE
GEETSTKYQAEEEQEEVYTSYKTSCNNKNKNSNNNVKISVYTQNTSVANTYMPLDTMTRR
RASWSLWWGGCLRPSTAACVTLLILTTTCSLCSASLCESQSWWDPYKDKCIPCTVCQGDM
IPLRPCQMHRDTVCGSIYDLKIDWVVLSKTEPNWKERRKFDGLDYGLDHHQLTAEQLQQL
QDEADPMDWQTAALFLAVLACLLFFIVAACILVHHMRQWRRMERRLDQDVEELSTKLMAK
LAEVQSLEGGTFFIGNADALRIPTSTTALTTATTFHQPQHVMLPEKSDKHQQSLQHDRRL
FTNTSTLKSGNVYIEENSSKC
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaacaacagctacacacccgcgcatttaacaaatcttaaaataacacctctcgttacc
aacaactcctcaagccgaacacaattcgacacaaccgcaacaaacacaaatgaaccatgt
tcgatccaaagtagactagaatccactaaccaatgcagtactcaggatcaagaagaggag
ggagaggagacgtctacgaaatatcaggcagaggaggaacaagaagaggtgtataccagt
tacaaaactagttgtaataataaaaataaaaatagcaataataatgttaagatatctgta
tatacacaaaataccagcgttgcaaatacatatatgcctttggacacgatgaccaggaga
agggcgtcgtggtcattgtggtggggcggctgtttgcgaccatcaacagcggcttgtgtt
acacttttaatattaacaacgacatgttccttatgttcagcctccctatgtgaatcgcaa
agttggtgggatccctacaaggataaatgtataccctgcactgtgtgccagggcgatatg
ataccattgagaccatgtcaaatgcatcgagacactgtgtgtggctcaatatatgatttg
aaaattgattgggtcgttttgtcgaagaccgaacccaattggaaggagcgacgaaagttt
gatggtttagattatggcttagaccaccaccagttaaccgccgaacaattgcaacagcta
caggatgaggccgatccaatggattggcaaacggctgcacttttcttggctgttttggca
tgtcttttatttttcattgtagccgcttgtattctagtacatcatatgcgacaatggcga
cgcatggaacgtagattagatcaagatgtcgaagaactttcaacaaaactcatggccaaa
ttggccgaggtacaaagtttagagggtggtacattctttattggtaatgcggatgcttta
aggataccaacgtcaacaacagcattgacaacagcaacaacatttcatcaaccacaacat
gttatgttgccagaaaaatcggataaacatcaacaaagtctacaacatgatcgtcgttta
ttcactaatacatcaactttaaaatctggtaatgtttatattgaggaaaatagttcaaaa
tgttaa

DBGET integrated database retrieval system