KEGG   Lucilia cuprina (Australian sheep blowfly): 111679643
Entry
111679643         CDS       T06013                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111679643
   04215 Apoptosis - multiple species
    111679643
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 111679643
NCBI-ProteinID: XP_023296997
LinkDB
Position
Unknown
AA seq 311 aa
MPNSLPHYNNNNDNYQQNGFASNNFGSSNFLSPNSINDRQSMLNAQSRRKFSFPATLHST
SLLEVNQNSTRRRLSNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGQYIKRRLRRS
GLFNKKLGLQRIRSILGTSTMSVVREVFPAVMVLGDELERMHPRIYTGVARQICRNPGGE
FKSADTVILLLSAVARDLFRIDITWSKIVSLFAIAGGLSVDCVRQGHPEYLPKLMQSVSD
VIEDELVPWINENGGWIGINNHVHPATNKLNPLEWTTIIVGSIFGLFLIYVLIRFLITYV
IPKIYQRITGK
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcccaattctttgccccattacaacaacaacaacgataattatcaacaaaatggtttc
gctagcaataatttcggttcatcgaattttctttctcccaatagtattaatgatcgccaa
tcaatgctgaatgcccaatctagaagaaaatttagttttcccgcaacactacactcgact
tcgctactagaagttaatcaaaattccacccgtagacgtttaagtaatgtaagtgatgtg
gtgacgagaaaattatcatataccataggctggaaggcggcacagataccggcccaggat
ataataacacaaggacgctgcctatgtggtcaatatataaaaagacgtttacgtcgctcc
ggattgtttaataaaaagttgggcctacaacgtatacgcagtattttaggtacatcgact
atgtcggtggtaagggaagtatttccagctgtcatggtgttaggcgatgaattagaacgt
atgcatccgcgtatctacactggagtagcaagacaaatttgccgaaatcccggtggagaa
tttaaatcagctgatactgtaattttactcttatcagctgtagctagagatctctttcgc
atcgatataacctggagtaaaatagtatcattatttgccattgcggggggattatctgtg
gattgtgtgcgacaaggtcatccagaatatttgcccaaactaatgcaaagtgtttcagat
gttatcgaagatgagctagtgccctggatcaacgaaaatggtggttggattggtattaat
aaccatgttcatccggccaccaacaaattaaatccgctggaatggaccacaattattgta
ggcagtatatttggtttatttttaatatatgttttaataagatttttaattacatatgta
attcccaaaatatatcagcgtattaccggtaaatga

DBGET integrated database retrieval system