KEGG   Lucilia cuprina (Australian sheep blowfly): 111680908Help
Entry
111680908         CDS       T06013                                 

Definition
(RefSeq) uncharacterized protein LOC111680908
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00562  Inositol phosphate metabolism
lcq01100  Metabolic pathways
lcq04068  FoxO signaling pathway
lcq04070  Phosphatidylinositol signaling system
lcq04140  Autophagy - animal
lcq04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111680908
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111680908
   04070 Phosphatidylinositol signaling system
    111680908
   04150 mTOR signaling pathway
    111680908
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111680908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcq01009]
    111680908
Enzymes [BR:lcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111680908
    3.1.3.48  protein-tyrosine-phosphatase
     111680908
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     111680908
Protein phosphatases and associated proteins [BR:lcq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    111680908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc DSPn PTPlike_phytase Bin3 CDKN3 Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 111680908
NCBI-ProteinID: XP_023298384
LinkDB All DBs
Position
Unknown
AA seq 1451 aa AA seqDB search
MFQQGGKFYLNASNWKRYQPLNYTNNNNKTKDRYQDIDNPNTTQTEHLKKLTCNFKHLNR
LRKTKTSNSQKTGLRKASSLYSISSVKERLENEAGSNTGIDIYRFKQKMANTLSVMTNVL
RNVVSKQRIRYKEKGFNLDLAYVCDNIIAMGYPADNYESMYRNPLGDVYKFLEDNHHDHY
KIYNLCLERSYDITKFHGRVSVYPFEDHNPPTIELILKFCDDVDNWLKADALNVAAVHCK
AGKGRTGTMICCYLLYSGQQRTAEDALACYDEKRTKDRKGVTIPSQRRYVQYFSKLMRLG
LPYERRTLQFCEIRFSKANTLHSQGSVHCSISVLQDKVQQLQNFPIDFRKHNVLDMKNPP
LPVAGDIKVELTKNNKKIFHFWFNTFFVTDSSAIEGEGDDVKLVYTLQKWEIDDVHKDKC
YPEDFKVELVFYVDDTNVDRDHMKVSSSNRLTSNHRTTMQNTGAVRMSTQNQQQSNNYSL
PQNNSSGSEMNYLCDQKSSSSTSVSSSLGVGGGTDTSNGYESIRSTAQRKIGVVPTFGNH
HSNHYMAATDVVNNSEVFSASIPAQHMTLPPSYMEQHQQQQQHHHLQQQQHKNNMPQQKQ
NQIQQQQQQQQKNMMTLAPTTNQRHLQRQVAGGGGGGDVHAHHPNNMDASIAFQPSTNVN
ANKSSSNSSSGNNSTHNMASNSYNHNHSNNSSKTSSVSSQSSSSAIGDNEEDWESGESQA
KQLEHITLLLSTSSITNTNTNPTPTLPTSPLLPSSTTTSPSNQPASPSPSTSTNPNCFPN
TLRNCKNLNSGITNSSNTSSSSTSSSTSVSSASKCPSNNKSKTSNSSCTNRVVGGDDDDD
DNNTYKNNDDDRKFKFKKLNSNQVVKPVPNTSTDTNTNSVEFKVGDNNITSSIACEAEVH
PNNRPKLMHLLMAPKNSQQQQQSPHKPIFKRKSSYKLVKGSNSNGNTLADCSDDSLASST
ALAAGSGGGVAISSKLKLKIKLKKNKLKLSQKFQWFQNYFRTDPVDFCENFVQQTTSMRR
NSMCSMASRTHKLSTTTPPSVTPPPPVVNAGSSCEQLDQATSVNSVSTSNASIATGDLCE
DYYSSICDNQLSFSNSPCKSPRSMADMASSISGGRAGGVAISHGSSLGSSFTRSVGVSNS
YLRERRETLPSCSSSHANNNRRNSNNVVIVAAKPAKIHAIGFNVKTTTNLARQDSFETNA
EEEDNDLKESPDSIYYTPSSALIHTGDANEHTNTAFVFPQVPEASEKALENVEQKPKKTN
VSTTTGSIITKPQAKYSLNLVIVKECTEPPLSSEITKPPSAGSNNESDGIDSDCCDIGHK
KIDELRLQDDIGSVTLSEELEMGKVTATTTAASVCSNSSSSGFCTSECCTTNSSSSSCNC
NPFAIDLERHVASVKQDQQHTTIREVIESSTNSDNDDGETLKNATKANDGELLNANTTEV
PTTSTTDKCDH
NT seq 4356 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacaaggaggtaaattttatttaaatgcatcaaattggaaacgttatcagcca
cttaattacacaaataacaataataaaacaaaggatagatatcaagatatcgataatcca
aacacaacgcaaacagaacatttaaaaaaactcacatgcaattttaaacatttaaataga
ttgagaaaaacaaaaacaagtaacagccaaaaaacgggtctaagaaaagcaagcagctta
tatagcattagtagcgttaaagaacgcttagaaaacgaggccggttctaataccggcatc
gatatttacaggtttaaacagaagatggccaatactctttccgttatgacgaacgtattg
agaaatgtggtcagcaaacagcgtatacgctacaaggagaaaggttttaatttggattta
gcctatgtttgtgataatattattgccatgggttatccagcggacaattatgagagtatg
taccgaaatcctttaggggatgtttacaaatttctagaagataatcatcatgatcattat
aaaatatataatctatgtcttgagcgcagctatgatattacaaagtttcatgggcgagtt
tctgtttacccatttgaggatcataacccacctacgatagaattgatactgaaattttgt
gatgatgtagacaattggctaaaagcagacgctctcaatgtggctgcggtacattgtaaa
gccggtaaaggtcggactggaaccatgatctgttgttatttgctttatagtggtcaacag
cgtacagctgaagatgctttagcatgttacgatgaaaaacgtaccaaggatcgcaagggt
gtaacgattccatcgcaacgtcgttatgttcagtatttttccaaattaatgagattgggt
ttaccgtacgagcgtcgtaccttacagttttgcgaaatacgtttttcaaaagccaatacg
ttacatagtcagggtagcgtacattgctcaatttctgtattacaagataaagtgcagcaa
ttgcaaaattttccaattgattttcgcaaacataatgtgctggatatgaagaatccaccc
ctacccgtagcgggtgatattaaagtcgaattaacgaaaaataataagaaaatatttcat
ttttggtttaatacattttttgtaactgattcttctgctattgagggtgaaggcgatgat
gttaaacttgtttatactttacaaaaatgggaaatcgatgatgtacacaaggacaaatgt
tatcctgaagattttaaggtggaacttgtgttttatgtcgatgacactaatgttgatcgt
gatcatatgaaagtatctagtagtaatcgtttaacttcaaatcatcggactacaatgcaa
aatactggagcagtgcgtatgtcaacacagaatcagcaacaatcaaacaactattcgttg
ccacagaataatagcagtggcagtgaaatgaactatttatgtgatcaaaaatcatcctca
tcgacatcggtcagtagtagtttaggggttggtggtggaacggatacaagtaatggctat
gaatcaattagaagtacagcacaacgaaagattggtgttgtgccaacgtttggtaatcat
catagcaatcactatatggcagctacagatgttgtcaataatagtgaagtgttttcagcg
tcaattcctgcacagcatatgacgctaccaccgagttatatggaacagcaccaacaacaa
caacagcatcatcatctacagcaacagcagcataaaaacaatatgccacaacagaaacag
aatcagattcaacaacagcaacaacaacagcagaagaatatgatgacactggccccaacg
acaaatcaaaggcatttgcaaagacaagttgctggtggtggaggtggaggagatgtacat
gctcatcatcccaacaatatggatgcttcaattgcatttcaaccgtccaccaatgtaaat
gccaacaaatccagtagcaacagcagcagtggcaacaatagcacccataacatggctagc
aacagctacaatcacaaccacagtaataatagcagcaagactagtagtgtcagtagccaa
tcatcgtcatcagccattggagataatgaagaggactgggaatccggtgagtcccaagct
aaacaacttgaacacattactttactactttctacttcctctataacaaatacaaataca
aatccaactccaacacttcctacttctcctcttctcccttcctctaccactacctctcct
tccaatcaacctgcttctccttctccttcaaccagtaccaacccaaactgtttccctaat
accctaagaaattgtaaaaatcttaatagcggtattaccaactcttccaatacctcttcc
tcatccacctcctcctccacttccgtatcctctgcttccaaatgtccttctaacaataaa
agtaaaactagcaatagtagttgtacaaatagagttgttggtggtgatgatgatgatgat
gataataatacatataaaaataatgacgacgacagaaaatttaaatttaagaaattaaac
tcgaaccaagtggtaaaaccagtccccaatacatcaacagatactaacactaattctgta
gagttcaaggtcggagacaacaatattacaagtagtattgcgtgtgaggctgaggttcat
cccaataatcgtcccaagttaatgcatctcttaatggcccccaaaaattcgcaacaacag
caacaatctccacacaaacctattttcaaacgtaaatcctcttataaactcgttaagggt
tccaattcaaacggcaacactttagccgattgctcagacgattctttagcctcctcaact
gcccttgctgcgggtagtgggggcggagtggcgatctcttcaaagctgaaactaaaaatc
aaattgaaaaagaacaaactaaagttgtcacaaaaatttcaatggtttcaaaactatttc
cgtactgatccagtggatttctgtgaaaactttgttcaacagaccacctccatgaggcgt
aatagtatgtgcagtatggctagtcgtacccacaaattgtccacgaccactccgccttcc
gtcaccccacccccgccagttgtaaatgcgggttcttcttgcgaacaattagatcaagcg
accagtgtcaattctgtgtccacatcgaatgcaagcatagccactggtgacctctgtgaa
gattattactcttccatctgtgacaatcaattaagctttagtaactcgccctgtaaaagt
ccacgctctatggcggacatggcaagtagtattagtggtggcagagctggtggcgttgcc
ataagccatggcagtagtctgggtagtagtttcacaagaagtgtaggagtttcaaattca
tatttacgcgagcgtagagaaacattgcccagttgcagcagttctcatgccaacaataat
cgacggaacagtaataatgtagtgattgtggcagctaagccggctaaaatacatgcaata
ggtttcaatgtcaaaacaacgacgaatttggccagacaggattcattcgaaacaaatgcc
gaagaagaggataatgatttaaaagagtcacccgacagtatttattacacaccgtctagc
gctttaatacacacaggtgacgctaacgaacacacaaatacagcatttgtttttccacaa
gtaccagaagcatctgaaaaggcgttagaaaatgtggagcaaaagcccaaaaaaactaac
gtttcgacaactaccgggtctataataacaaagccacaggcgaaatattctttaaatttg
gtcatagtgaaagaatgcactgaaccgccattatcctctgaaataacgaaaccaccatca
gctggcagtaataatgaatcggatggcattgattcagactgttgtgatattggccacaag
aaaatagacgaacttaggctacaagacgatattggttcggtcacactgtcagaagaacta
gagatgggcaaagtaacagccactactacggcggcctctgtgtgcagcaatagtagtagc
agtggtttctgtaccagtgaatgttgtactacaaatagtagtagcagtagttgtaattgc
aatccattcgcaattgatttagaacgacatgtggcctccgttaaacaagatcaacaacac
accacaatacgagaagttatcgaatcttctactaatagcgataacgacgatggcgaaacg
ttaaaaaacgcaactaaggcaaatgatggtgaacttttaaatgcgaacaccacagaggta
ccgacaacttctactaccgataaatgtgatcattaa

DBGET integrated database retrieval system