KEGG   Lucilia cuprina (Australian sheep blowfly): 111682375Help
Entry
111682375         CDS       T06013                                 

Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcq03036]
    111682375
Chromosome and associated proteins [BR:lcq03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    111682375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 111682375
NCBI-ProteinID: XP_023300075
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MYERSSLRYAHTTGFTSLIYTDNGEYILTCGSDGDVRKWRGIDDDDPSSNCLGEYIICLA
QKGNKLLASTDRNTVQAYTFPDMDLDGTLMRFTAPVVSIKVRDDCVVAGSEDTKIKVKNG
ELEPIELEGHKGPVLALDIHPSLNFLASVGGEGNLKIWSLKEGKEIKTVTGLTKSNSFEN
ATCFGSPCFEPSNGNSLAYVNGKKILVLSTSTWEMQFSLTDDKIKGEYTCCQFSKDGLFL
AAATDKGEISVFDFNSRQAKKCEAPSNECQSITCLAWNSKNNGEIAYCDASGQLGVLFSA
NDALEDDAMEEDTGNGDNVFGEIEFAEDDSKSIDKRVLGIGDDANDYGDDDDDDAVSIEK
LKSKIMSYGNDDVQCDEGTRDSIERGRSESPSISGAAYIKTFKQQLPFQPSSTPTHLEHR
YLVWNNIGIVTLHADGSDGAIDVEFHDASVHHSLHIPNYNNHSMASLSSSVLAMASESSS
KIVCIALSASGNREWSLQLPDCESVEAICATSKMVATVSNLQFLRIFTVMGTQREIISVP
GPVICMAGYEDRILVCYHSAPSSVKQQNIQGMLLQTSGFKIKCQNITIPLTPERQLVWLG
FSDCGSPVFYDSMGLVQLFNLKSNCWYPVCDTMKQSSSVSNNYFIISLSERSQILQAVLC
RGTSYPMTTPRPMVQELQLQLPLCDIESEKSSLEDSLLRATIMSMDNAEKTVKETAIKLF
ALACRSEIEVRAKELIETIACTDLLMLAVKYATKLGRIHLSDKLSDLLPQIEEEQQTREH
EELLVEQSLPASPLILLKAYQNGSSSNSKKLAPKTMDLGSAKKTTLKRFSYNSSSPSISL
FKKSTHEQILPSSSETSQENISNSELDSQLSKSSSKVDESIITRTPLNSVNPFASKRKLS
DVDKTILMGSEKLKIAKK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcgtagttctttgcgttatgctcatactacgggcttcactagtttaatatat
acggataatggagaatatattttgacatgtggttcagatggcgatgttcgcaaatggcga
ggcatagatgatgatgacccctcgtccaactgtttaggagaatacataatttgtttggcc
caaaaagggaacaagttattggcttctacagatcgtaatacagtgcaggcatacactttc
ccagatatggacctcgacggaacattaatgcgttttacagcgcctgttgtatctattaag
gtgagggatgattgcgtagttgctggttctgaagatacaaaaataaaagtaaaaaatgga
gagttagaaccaattgaattagaaggacacaaaggtccagtgctggcgttggatatacat
ccgagtctcaattttttggcatcagttggtggcgagggcaatctaaaaatctggagtcta
aaagaaggcaaagaaattaaaacagttacaggattaactaaaagcaacagctttgagaat
gcaacatgttttggaagtccttgttttgagccaagcaatgggaacagtcttgcctatgtt
aatggtaaaaaaattcttgtcctaagtacttcaacgtgggaaatgcaattctccctcaca
gacgataaaattaaaggagagtacacatgttgtcaattttctaaggatggattattctta
gcagccgccaccgataagggggagatttctgtttttgattttaacagcaggcaggctaaa
aaatgtgaagcgccgtctaatgaatgccaaagtataacatgcttagcttggaatagtaaa
aataatggggaaatagcttattgtgacgcttcaggtcagttaggtgtattgttttctgca
aacgatgctcttgaagatgacgccatggaggaagacactggaaatggcgataatgttttt
ggtgaaatagaattcgctgaagatgattctaaaagtattgataagagggtgctgggtatt
ggggatgatgccaacgactacggcgatgatgatgatgatgatgcagtatcaattgaaaaa
ttaaaaagtaaaattatgtcttacggaaatgatgatgttcaatgtgatgaaggaaccagg
gattctattgaaagagggcgttcagaaagtccatcaatttcgggagctgcttacatcaaa
acatttaaacagcaattacccttccagcccagttcaactcccacccacttagaacatcgt
tatttagtgtggaacaacattggtatagtaacgttgcacgctgatgggtcggatggagct
atagatgttgaatttcacgatgctagtgtacaccactcgttgcatattccaaattataat
aatcatagtatggcaagtttaagctcctcagttttggccatggcttcagagagttcgtca
aaaattgtttgcatagcattatctgcttcaggaaatagagagtggtccctgcaattacca
gattgtgaaagtgtcgaagctatatgtgcaacatcgaaaatggtagctacagtctcaaat
ttgcaatttcttagaatttttacggtgatgggaacacaaagggaaataatttcggtaccc
ggtccggtgatatgcatggctgggtatgaagatagaattttagtttgctaccacagtgcc
ccatcgagcgtaaaacaacaaaacatacagggcatgttactgcagacatcaggctttaaa
ataaagtgccaaaatataacaatacctcttacgccggaaagacaattggtttggctggga
ttttctgattgtggttcccctgttttctatgactctatgggattggttcagttgtttaat
ctgaaatcgaattgttggtacccagtttgcgataccatgaaacaatcctcaagcgtatcg
aataattattttattatttctctttcggaaagatcacaaattcttcaagccgttctttgt
cgaggaacttcatatcctatgaccactccgcgcccaatggtgcaagagttacaattgcaa
ttgccactttgtgatatagaaagtgaaaaatcgtccctggaagattccctattacgcgca
actataatgtcaatggacaacgcagaaaaaacagttaaagagactgccataaaattattt
gctttggcctgtcgtagtgaaatagaagtaagagcgaaagaacttattgaaaccattgct
tgtacagatctgctaatgctggctgtaaagtatgcaacaaaactggggaggatccattta
tcagataaactttctgatttgctgccacaaattgaagaagagcaacaaacaagggaacac
gaagagctcttagttgagcaatctctacctgcatcacccctcattttgttaaaggcctat
caaaatggttcatcttcgaactcaaaaaagttagcacccaagacaatggatttgggttca
gcaaaaaaaactactttaaaaaggttttcatacaacagtagttccccttcaatatctttg
ttcaaaaaatctacgcacgaacaaattttaccatcgtcttcagaaacatctcaggaaaat
atcagtaattccgaattagattctcaattatcaaaaagctcatcgaaggttgatgaatcc
attattacacggacacctttgaattcagtaaatccatttgcatctaagcgcaaactttca
gacgttgataagactatattaatgggttctgaaaaattgaaaattgctaaaaaatga

DBGET integrated database retrieval system