KEGG   Lucilia cuprina (Australian sheep blowfly): 111687547
Entry
111687547         CDS       T06013                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq04013  MAPK signaling pathway - fly
lcq04214  Apoptosis - fly
lcq04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111687547
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111687547
   04215 Apoptosis - multiple species
    111687547
SSDB
Other DBs
NCBI-GeneID: 111687547
NCBI-ProteinID: XP_023305760
LinkDB
Position
Unknown
AA seq 307 aa
MAVPFYLPEGGADDTVSSGGTTSSDGASSAASSLQSSPNTTSSATQTPMQSPLLPGEVIM
AIYELIRYNSGAPVFQYPTPPSPSCSIHSPSYTGGEVFFPRSRSTPRIPRTSVSFAPGDE
VNFFHQSAPAASSGNAQTQTTQAPQSAPPVPNSHHHNQHQLYGHHPHFAYQHSGPSYYQY
TPPPTPNTATATTSTGTSTSGAGGMTHRSLHRSLSDSARRSRLTSTGEDEREYQSEHETS
WDEFEDRYDNFTAGRERLQEFNGRIPPRKKKKDVPKTKPEKKEQSFTWPAVVTVFVFAMG
CGFLVAR
NT seq 924 nt   +upstreamnt  +downstreamnt
atggctgtgcccttttatttgccagagggtggtgccgatgataccgtatcatccggcggc
accacttcatccgatggcgctagcagtgcagctagctcattgcaatcctcccccaatacc
acctcttcggccacacaaactcccatgcagagtcctttactgccaggcgaagttattatg
gcaatttatgaattgatacgatataattcaggtgctcccgtttttcaatacccaacacca
cccagcccttcgtgttcgatacatagtccttcctatacaggaggagaagtattctttcca
cgcagtcgcagtacccccagaataccacgcacaagcgttagttttgctcccggcgatgag
gtgaacttctttcatcaatcagcgccagccgcatctagtggcaatgcacaaactcaaact
acacaagcacctcagtcagctccaccagtaccaaacagtcatcatcacaaccagcatcaa
ctctacggccatcatccacactttgcctatcaacatagtggaccaagttattatcaatat
acaccgcctcctacacccaacactgccacggcaaccacctcaacgggtacttcaacaagt
ggagcgggtggtatgacccatagaagtttacatcgttcgctgtcagattcagccagaaga
tcacgtttaacctcaacgggtgaagatgagcgagaatatcaaagtgaacatgagaccagt
tgggatgagttcgaagatcgttatgataattttaccgctggccgagaaaggctgcaagaa
tttaatggtcgtataccgccacgtaaaaagaaaaaggatgtgccaaaaactaaaccagaa
aagaaggaacaaagctttacctggcctgctgtagttacggtcttcgtttttgccatgggt
tgtggatttctagtagcccgatga

DBGET integrated database retrieval system