KEGG   Lactobacillus casei BD-II: LCBD_2376Help
Entry
LCBD_2376         CDS       T01955                                 

Gene name
cydC1
Definition
(GenBank) Putative ABC transporter
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LCBD_2376 (cydC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcs02000]
    LCBD_2376 (cydC1)
Transporters [BR:lcs02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    LCBD_2376 (cydC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 RsgA_GTPase T2SSE SMC_N NACHT AAA_29 AAA_33 AAA_24 AAA_35 AAA_22 DUF87 TctB NTPase_1 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AEA57871
UniProt: A0A454XJC4
LinkDB All DBs
Position
complement(2328914..2330641)
Genome map
AA seq 575 aa AA seqDB search
MHWLKNEHWVRPDLKRYRGLLFWSLILGIMTFVFAGALMFTSGFLIDKSATKPLFAAIYV
TVVLTRAFGIGRPVFQYIERLTSHNWVLRITSHMRRKLYKVLETDAAFVSEHHQTGDILG
LLADDIGHIQNLYLRMIFPTVVGAGLTVIATLLLGWFNWGFALWIMLLLLFQVLILPWWG
LVVERFRKAEQKQLNHDAYVSLTDSVLGLSDWVITHREKDFMSQSLAAPKKLAASTVKSK
RFQWRRDFVGQLLFVLIVISMLIWTNLEWTGNQASANWVGAFVLVVFPLDQAFSGIAQGV
GEWPTYRDAIRHLNDLQPVTRQLPQQQAVPTQFKEMTLQHLSFQYTPKDPELITDIDLTV
HSGEKIAILGPSGMGKTTLLQLVLGDLTPTTGNVLIDGQDVLTYQQHRTNLFAVLDQSPF
LFNTSIVNNVRLGNEQASDADVAAALKAVKLDQLVAQLPNGINSSVEEAGFGFSGGERQR
LSLARILLQDAPIVLLDEPTVGLDPITEQALLETMFTVLQGKTILWVTHHLQGVNQTDRV
IFLEDGRLTMNDTPSHLAKNDERYQNLYALDAGLR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcattggttgaaaaatgagcactgggttcgcccagacttgaaacgctatcgcggctta
ctcttctggtcgttaattctggggattatgacctttgtctttgctggtgccttgatgttc
acgtcaggttttctgattgataaaagtgccacgaagccattgtttgcagctatttatgtc
acggttgtcttgacccgcgcttttgggattgggcgaccggtgtttcaatacattgaacgg
ttgaccagtcacaactgggtgttgcgcattactagccacatgcggcgaaaattgtacaaa
gtgttggaaactgatgctgcctttgtgtccgaacatcatcaaaccggcgatattctaggc
ttgctcgccgatgacattggtcacattcagaatctatacttgcggatgatttttccaact
gtggtcggcgctggtctaacggttattgccaccttgttgctaggctggttcaactggggc
tttgcactatggattatgttgttgctgttgtttcaagtattgattctgccttggtgggga
ctggtagttgagcgttttcgaaaggcagaacaaaagcaattgaatcatgatgcctatgtc
tcattgacggattcagtgctcggtttgtccgattgggtcattactcatcgcgaaaaggat
tttatgtctcaaagtctggcggcgcctaaaaaattggccgcatcgacggtgaagtccaag
cggtttcaatggcgccgagactttgtcggccaactgctgtttgtcttaattgtcattagt
atgttgatctggacaaaccttgagtggaccggtaatcaagcgagtgctaactgggttggg
gcgtttgtactggttgttttcccactcgatcaggcgttttccggcatcgcacaaggggtt
ggcgaatggccgacataccgagatgcgattcgtcatctcaacgatttgcagccggtcacg
cgacaattaccgcaacaacaagcagtaccgactcagttcaaagagatgacattgcagcat
ctcagttttcaatacacgccaaaagatcctgaattaattaccgatattgatctaaccgtt
cacagcggcgagaaaattgcgattctcggacccagtggcatgggcaaaaccacgttgttg
caactggtccttggtgacctaacgccgacaactggcaacgtgttgatcgacggtcaagat
gtcctgacttatcagcagcatcgcaccaatctttttgcggtgttggatcaaagtccgttt
ttattcaacacgtcgattgtcaacaatgtccgcttaggcaatgagcaggccagcgatgct
gatgttgccgctgctcttaaggcagtcaagctagaccagctcgtagcccaattgccgaat
ggtattaacagcagtgtcgaggaagcaggtttcggcttttcaggtggtgaacggcaacgt
ttgtcgctagctcgaattcttttacaggatgcgccgattgtgctgttggatgaaccgaca
gtcggccttgatccaattacggaacaggctttgctggagacgatgttcacagtattgcaa
ggcaaaaccattctttgggtgacgcatcatttgcaaggcgtcaatcaaactgatcgcgtc
atttttcttgaagatggccgtttgacgatgaatgatacccctagtcacttggctaagaac
gacgagcggtatcagaacttgtatgctttggatgcggggctacggtga

DBGET integrated database retrieval system