KEGG   Lactobacillus curieae: PL11_003345Help
Entry
PL11_003345       CDS       T04707                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PL11_003345
Enzymes [BR:lcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PL11_003345
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PL11_003345
    1.1.1.-  
     PL11_003345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N 3HCDH_N Titin_Z
Motif
Other DBs
NCBI-ProteinID: AQW21020
UniProt: A0A1S6QHD7
LinkDB All DBs
Position
691764..692813
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDIRVEDVDLKPHKDNEVVVKVAWAGICGSDLHEYLEGPVFIPVDHTDELT
GGHAPLTMGHEFSGVIQEVGKDVTKFKVGDHVSINPTITHHNVPDDIDVYDGYSFIGLST
DGGFTSLVNVPEENLYSLPADFPLELAATIEPTAVAVQAVKEGGLKFGETVAIFGAGPIG
VLVAAAAKAAGATKIISVDLSEVRLDKAKEMGATDVINPANDDAIKKIHELVPNGVDVSF
EVAGVQPTFEQAIDATKARGKMVIVSIFARPIQFNPMQLMNSGVQITTTIAYSMETFQQT
VDLVSSGQINVKPVITKHIDLDNIVNDGFEALTTDKSQAKILINLEKES
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcacggtgttaaagatattcgcgttgaagatgttgatttaaaa
ccgcacaaggacaatgaggttgttgttaaagtcgcctgggcagggatttgtggaagtgac
cttcatgagtatttggaaggcccagtgttcattccggttgaccacaccgatgaattaacc
ggcggtcatgccccattaacaatgggacacgaattttctggtgtaattcaagaagttggt
aaagatgtcactaaatttaaagttggggatcacgtatcaatcaacccaaccatcacccat
cataatgttcctgacgacattgatgtttacgatgggtacagtttcattggtcttagtact
gatggtgggttcacttcacttgtaaatgttcctgaagaaaacctatattcattacctgct
gacttcccattagaactcgcagcaaccatcgagccaactgccgtagctgtgcaagcagtt
aaagaaggtggcctaaaattcggtgaaaccgtagcaatttttggagctggaccaattggc
gtattggttgccgcggctgctaaagcagctggtgccacaaagattatttcggttgattta
tcagaagttcgtttagataaagctaaagaaatgggtgcaaccgatgtaattaacccagct
aacgacgacgcaattaagaaaatccatgaactcgtaccaaatggtgtagatgtatccttt
gaagttgctggtgttcagccaacatttgaacaagcaattgacgctacgaaggctcgaggt
aagatggtaatcgtgtcaatttttgctcgaccaatccagttcaacccaatgcaattaatg
aactccggagttcaaattactaccacaattgcatactcaatggaaaccttccaacaaaca
gttgaccttgtatcaagtggtcaaattaacgtcaaaccagtaattaccaaacatattgat
cttgataatatcgttaatgacggatttgaagcattaactacggataagtcacaggcgaag
attttgattaatttggagaaggaatcgtaa

DBGET integrated database retrieval system