KEGG   Lactobacillus curieae: PL11_007585Help
Entry
PL11_007585       CDS       T04707                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00030  Pentose phosphate pathway
lcu01100  Metabolic pathways
lcu01110  Biosynthesis of secondary metabolites
lcu01120  Microbial metabolism in diverse environments
lcu01130  Biosynthesis of antibiotics
lcu01200  Carbon metabolism
lcu01230  Biosynthesis of amino acids
Module
lcu_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PL11_007585
Enzymes [BR:lcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PL11_007585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC AAA_30 Sugar-bind ACT_4
Motif
Other DBs
NCBI-ProteinID: AQW21784
UniProt: A0A1S6QJK3
LinkDB All DBs
Position
complement(1576649..1577329)
Genome map
AA seq 226 aa AA seqDB search
MTQDELKQLVGKAAVDFIEDGMTVGLGTGSTVKYMVDALGEKVKKQGINIVGVSTSKRTA
EQATALGIEIKDVDEVDHIDLTIDGADQIDKNFQGIKGGGAAHLWEKIVAINSNKNMWIV
DESKMADELGSFPLPLEVIPYGSKQLFKRLEAKGYHPEFRMANGKHVLTDSDNFVIDLHM
GHISEPQELAKDLDSMTGIVEHGLFLDLVNTVIVGREGGPQILKAR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatgaattaaaacaattagtaggtaaggctgcagtcgacttcattgaagat
ggaatgacggtcggcttaggaactggttcaaccgttaaatacatggtcgatgccttaggt
gaaaaagtaaaaaaacaaggaatcaacattgttggggtttcaacatcgaagcgaactgct
gaacaagcaactgcactaggaattgaaattaaagatgttgacgaagttgaccacattgat
ctaactattgacggagctgaccaaatcgataaaaacttccaaggaatcaagggtggcggc
gccgctcacctttgggaaaagattgtcgccattaattcaaacaaaaatatgtggattgtc
gacgagagcaagatggctgatgaattgggatcattccctctcccacttgaagttatccct
tatggtagcaagcaattgtttaaacggcttgaagctaaggggtaccaccctgaatttaga
atggctaatgggaaacacgtgcttacagattcagacaattttgtgattgatctgcatatg
ggccacatctcagaacctcaagaactcgcaaaggacttagactcaatgactgggattgtt
gaacatgggttgttcctggacttagtaaatacagttattgtcggccgagaaggtggtcca
caaattcttaaagcccgctaa

DBGET integrated database retrieval system