KEGG   Lactobacillus curieae: PL11_008830Help
Entry
PL11_008830       CDS       T04707                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lcu  Lactobacillus curieae
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcu01001]
    PL11_008830
Enzymes [BR:lcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PL11_008830
Protein kinases [BR:lcu01001]
 Serine/threonine kinases: Other
  Bacterial family
   PL11_008830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH Haspin_kinase Kinase-like Seadorna_VP7 CrgA
Motif
Other DBs
NCBI-ProteinID: AQW22015
UniProt: A0A1S6QK79
LinkDB All DBs
Position
1818808..1820868
Genome map
AA seq 686 aa AA seqDB search
MNKGYVLNGRYEIIARLGEGGMADVYLAKDLILNRQVAVKLLRLDFRDNPRAKERFQNEA
LAVTQLNNPHIVGVYDVDEVDGMQYIVMENVEGEDLKDYIRDHSPIPYPTVVDIMEQICS
AVGEAHRHNIIHRDLKPQNILVNNNGYVKITDFGISRAATEDTMTQTRSIIGSIHYLSPE
QIKGMVATKQSDVYSLGIILYEMLTGKVPFDGETAVSIAMKHSQESIPFVKDTNPRIPQP
LENAVLKATAKNPTDRYLTVDDLADDLKTSLSVNRLTEPRFVPSEDNSETDGKTRVMPFS
PLADTNLAKANEDKQEESEPEEHQREEKPRRKHHKRRWIILGIVLLLLIGLGTLIATANG
STHVPQVSGLTETDAKEKITDAKLKVGKVRYKNSYSVDKNRVISSDPDEGQKVDKQSKVD
LVISSGIRMVRLDNYVGQSFNSVSAKLKNEGFKIKRRNAPSSTFGPGKILQQGFKAGTSA
DPNKKTLSFVVSTGIKEITLKDLTGMTKEQVVDYSNTAEINPTFEYAYSNDTPKGKVIRQ
APVAGERIQQGGSLMVYISRGKKTSNEIKSFNVRVTIPYHENPSSVTDQSDSSNSSETSS
TLGTAPVTNSSSLEESSSDDSQENVILIYLKDHDHDYTHVYKQMVIQRDTTVLLPFKLTK
DEIGKYKIVRDGKTILRDNNITYEMH
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggttacgtcttaaatggtcgttacgaaatcattgctcgtttgggtgaaggt
ggaatggctgacgtttacttggccaaagacttaattttaaatcggcaagttgcggttaaa
ctgctgcgattagattttagggataacccgcgggcaaaggaacgctttcaaaatgaggca
cttgctgttacccaactaaacaatccgcatattgttggagtttatgatgttgacgaagtc
gatggaatgcagtacatcgtcatggaaaacgttgagggtgaggatttaaaagattacatt
cgcgatcattcgcctattccttatccgacagttgtcgacattatggaacagatttgtagt
gctgttggtgaggcacatagacacaatataattcaccgtgacttaaagccgcaaaacatt
ctggttaacaataatggttacgttaagattactgattttggtatttctcgggcggctact
gaagacactatgacccagactcgctcaataattggttcgattcattatttatctcctgag
caaataaagggcatggtagccactaagcagtctgatgtgtactcccttggaatcattctt
tatgaaatgcttacagggaaagttccgtttgatggagaaaccgccgtttcaattgcaatg
aaacattctcaggagtcaattccgtttgtaaaggatactaatccgagaattccccaacca
cttgaaaatgcagttttaaaggccactgccaagaatcccactgatcgatacttaaccgtg
gatgaccttgcagatgacttaaaaacgtcgttgtctgtcaacagattaacagaacctcgt
tttgttcctagtgaagacaatagtgagacagatggtaaaactagggtgatgccattctcg
ccgttggccgatactaatttagccaaagctaacgaagacaaacaagaggaatctgaacct
gaggaacaccagcgagaagaaaagccacgaagaaagcatcacaagcgtcgctggataatt
ttgggaattgttttgttacttctgattggattaggaacactaattgcgacagctaatggt
agtacccatgtccctcaagtgtctggattgactgaaactgatgcaaaagagaaaattacc
gatgctaagctcaaggttggtaaggttcggtacaaaaacagttattcagtagacaaaaat
cgggtaattagttctgatcccgatgaaggccaaaaagtggataagcagtctaaagttgac
ttggtgattagttctggaatcagaatggttcgtttggataattatgttggccagtcattt
aattcggtatcggctaagctgaaaaatgaaggatttaaaatcaagcgtagaaacgctcct
tctagcacttttggaccaggcaaaattttgcaacaaggatttaaggctgggaccagtgca
gatcctaataaaaagactttgtcgttcgtggtctcaacagggattaaagagattaccctg
aaagatttaacagggatgactaaggaacaagttgtcgattactcgaatacggctgaaatc
aatccaacctttgagtacgcctattcaaatgacacccccaaaggaaaggtcatccgtcaa
gctccagttgctggtgagagaattcagcaaggtggtagtttaatggtctacatctctcgt
gggaagaagacttctaacgaaattaaaagctttaatgttcgggtaacgattccatatcac
gagaacccatcctcagtcacggatcagagtgatagtagtaatagttcagagacaagttct
acattaggaacagctcccgtaactaacagctcatccttggaggaaagctcatcagatgac
tctcaggaaaatgtaattttaatttacctaaaagatcatgatcacgactacacgcatgtt
tataaacagatggtgattcagcgtgatacgactgtcctattaccgttcaagttgactaaa
gatgaaattggtaaatacaaaattgttcgtgatggcaagacgattcttagagataacaac
atcacttacgaaatgcattag

DBGET integrated database retrieval system