KEGG   Lactobacillus casei W56: BN194_11800Help
Entry
BN194_11800       CDS       T02337                                 

Gene name
yclK
Definition
(GenBank) Sensor histidine kinase yclK
Organism
lcw  Lactobacillus casei W56
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5 Med30 DUF4229
Motif
Other DBs
NCBI-ProteinID: CCK22127
UniProt: K0N420
LinkDB All DBs
Position
1160097..1161572
Genome map
AA seq 491 aa AA seqDB search
MKMLYQQLIGFFSVIMVTLVIVSILFIRSTTNTVWENGFKQLEQYTDVLKNNAVDENTYV
INARFIQNAEEILSDQHVHFVIYDANNVAKYPVSQKGQMPAIKASYWKKLKQGAAVAVPE
MMTNPISGHAQSMTIYYQPVFLSEKLLFVIAAFAPVEQIQSSISKTEHNLLIAFVLSTLA
AFIISYFIASYQVRRINQLRRATHQVAEGNYDVEVKIKSRSHDEVAELADDFRDMVTSLK
ASQQEIQRQEDRRRQFMADAAHEMRTPLTTINGLLEGLAYDAIPEESKGKSIELMRNETN
RLIRLVNENLDYEKIRTNQILLSKQTFNARTDLDNIAEQLAQKSEEAGDKITIDAPADLP
TYADHDRFVQILFNIVQNAVQFTKNGQITIKAKVGYHQTEFAISDTGIGMSKDQMKNIWE
RYYKADPSRKNTKYGESGLGMAIVHQLMGQHGGTIHVDSTLGKGTTFTLTFPDEATAPKQ
KQPGADQQTSS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgctctaccagcagctgattggctttttctcagtcattatggtgaccttagtg
attgtctcgattctgtttattcggtctaccacgaacacggtttgggaaaatggctttaaa
cagttagagcaatacacggatgttttaaaaaataatgcggttgatgaaaatacttacgtc
atcaatgccagatttattcaaaatgctgaagagattttaagcgatcaacacgtgcatttt
gttatttatgatgccaataacgttgctaaatatcctgtgtcccaaaaaggtcagatgcca
gcgatcaaggcaagctattggaaaaagctaaagcaaggggcggctgttgccgtcccggag
atgatgacgaatccaatcagcggccatgcacaaagcatgacgatctattatcaaccggtt
tttctgagtgaaaaattactctttgtgattgccgcctttgcgccagttgagcaaattcaa
agttcaattagcaaaactgagcataatttgcttatcgcgttcgtactgtcaacgcttgcg
gcgttcatcatcagttatttcattgcgtcctatcaggtgcggcggattaatcaattacgg
cgcgcaacgcatcaagtggcagaaggcaattatgatgttgaagtaaaaattaaaagccgc
agtcatgatgaagttgcggaactggccgatgattttcgcgacatggtgacctcactgaaa
gctagtcagcaagaaattcaacggcaggaagatcggcgccggcagtttatggctgatgcg
gctcatgaaatgcggaccccgctgacaacaatcaatggcttacttgaaggcttggcctat
gatgccatccctgaagaaagtaagggaaagagtatcgaattaatgcggaacgaaacgaac
cgcttgattcggcttgtcaacgagaaccttgattatgaaaaaattcggacaaatcaaatt
ttgctcagcaaacagacgtttaacgcgcgcacggatcttgataacatcgcggaacagctg
gcgcagaaatccgaagaggctggtgataagatcacaattgatgccccagcagatctgccg
acatatgctgatcatgatcggttcgttcagattcttttcaacattgttcaaaatgcggtc
caattcactaaaaatggtcaaatcaccataaaagcaaaagtggggtatcatcagactgaa
tttgccattagcgatactggtattggtatgtccaaggatcagatgaagaatatttgggag
cggtattacaaggccgatccgtcacgtaaaaacaccaaatatggtgagtccggtttgggc
atggcgattgtgcatcagttaatggggcaacacggtggcaccattcatgttgattcgacc
ctaggcaaaggtacaacctttacgttgaccttcccagatgaagcgacagcgcctaagcaa
aagcagccaggagccgatcagcagacctcatcatga

DBGET integrated database retrieval system