KEGG   Lactobacillus casei 12A: LCA12A_0453Help
Entry
LCA12A_0453       CDS       T03665                                 

Definition
(GenBank) hypothetical protein
Organism
lcx  Lactobacillus casei 12A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 Shikimate_DH TrkA_N Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: EKP96319
LinkDB All DBs
Position
complement(2742157..2743161)
Genome map
AA seq 334 aa AA seqDB search
MKAGFYVGDYTYEVREVPDREPQKDEVKIRVAWCGICGTDVHKFQGKNGASVVIPPIILG
HECSGIVESVGPEVAYFKPGDRVACDPSYGCGKCIWCQRGFPNFCLVRHGVAKGLADYVF
PPEQNVYHISDSLDLEDAAFTEPLSCAIHGVDLMQMASGMTTVLYGLGAVGSLILQLVRE
TGQSNVIVVEREAKKRALALRLGATEAITDQEIEAVAKNKNIDYVYECIGLRSTMEQAIQ
IAGKNAKVMLFGLGDPDQPIKFNQFEAYTKELSIYTSFLNPHTSARAVSLLERGKIDTRQ
IISAEIELADAGKELATQENLRNGKVMIRLSGEH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctgggttttatgtcggtgactacacttatgaagttcgcgaggttcctgatcgg
gagcctcaaaaagatgaagtgaagattcgggttgcatggtgcggcatctgtggaacggac
gtgcataaatttcaggggaaaaatggtgccagtgtcgtcataccacccattattttaggc
catgaatgttctggcatcgttgagtcggttggacctgaagttgcctattttaaaccaggt
gatcgagttgcatgtgatccaagctacggttgtggaaagtgcatttggtgtcaaaggggg
ttccccaatttttgcttagtgcggcatggggttgccaaagggctggctgattatgtgttc
ccaccagagcaaaatgtttatcatatctctgattcacttgatttagaagatgctgctttt
acggaacccttgtcctgtgctattcatggcgttgatttgatgcagatggcttcggggatg
acaacggtcttgtatggactaggagctgttggatcactaattctgcagctcgttagggaa
actgggcaaagcaatgtcattgttgtggaaagagaggcgaaaaaacgggcattagcgcta
cggttgggagcgacggaggcaattacagatcaggaaattgaagcagtcgcaaaaaataaa
aatattgattatgtgtatgaatgtattggtttacgctcaaccatggaacaagctattcag
attgccggtaaaaacgcgaaagtcatgttatttggattaggtgatccagaccagcctatt
aaatttaatcaatttgaagcctatacaaaagaactgagcatttatacttcattcttgaat
ccacatacatctgcacgagcagtgagtttattggaaagagggaaaattgatactcgccaa
attattagtgccgaaatcgagcttgctgacgcaggaaaagaactcgcaactcaagaaaac
ttgcgcaacggtaaggtgatgattcgtcttagtggtgaacattga

DBGET integrated database retrieval system