KEGG   Lactobacillus casei 12A: LCA12A_1368Help
Entry
LCA12A_1368       CDS       T03665                                 

Definition
(GenBank) putative amino acid ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
lcx  Lactobacillus casei 12A
Pathway
lcx00550  Peptidoglycan biosynthesis
lcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCA12A_1368
Enzymes [BR:lcx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     LCA12A_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M zinc_ribbon_10 OrfB_Zn_ribbon Zn_ribbon_17
Motif
Other DBs
NCBI-ProteinID: EKP99694
LinkDB All DBs
Position
complement(1127687..1129039)
Genome map
AA seq 450 aa AA seqDB search
MAFSAKASLATAIGRSSYWFLHTFLKGGSSLPGQIANRIDPQVLRTLGQNYDVIVVTGTN
GKTLTTSLIVKVLKKKYKEVLTNPTGSNMLQGITTAFLVQPKRGHGRGIAVLEVDEANVA
PVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGVTRDPEAMVIANGDAPIFSSRKL
PNPVTYYGFELTANGDHKAPPNTDGVLCPVCQHILHYHAQTYANLGNYFCPHCGFKRPAL
THQITEVTQMTPQSSDFTIDDQPCHIDIGGMYNIYNALAAFAVGRAFGVTPTEISQAFAY
DEKVFGRQEVIQLGKKKLTLILVKNPVGLNQVLSMIETAKQPFGFAMLLNANYADGIDTS
WIWDGNFEELVASQKAASYLVGGERYKDIGLRLTVAGVPEKALVSKPALDDVISTLKRSP
QDQLYVLATYTAMLQLRKKLSDGGYIKAGF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggcattttctgcaaaagctagcctggcaactgccattggtcgcagcagttactggttc
ttacacacatttctaaaaggcgggtcgagcctaccaggccagatcgccaaccgaattgat
ccccaagtcttgcggacgctcggtcaaaactacgatgttattgtggtgactggaacaaat
ggcaagacgttgaccaccagcctgattgttaaggtgcttaaaaagaaatataaagaagtc
ttaacgaaccccactggctccaacatgttgcaaggtatcacaacggcttttttggtccag
ccgaagcgcggtcatggccgcggtatcgctgtgctcgaagtcgatgaggccaatgttgca
ccagttgccgctcagttaaaacccaaggcctttgttctcaccaatattttccgcgaccag
atggaccgttatggggaattttataccacctatcagaaaattttagacggtgtgacacgc
gatcctgaagcgatggtcattgctaatggcgacgctccgattttcagctcccgaaagctg
cctaatccagtcacctactatggctttgaactcacggcaaatggcgatcataaagccccg
ccgaatacggacggtgtcttatgtccggtatgtcagcacattctgcactaccatgcacaa
acttacgccaatttgggcaattatttttgtccgcattgcggcttcaaacgccccgcttta
acccatcaaatcaccgaggtcacccaaatgaccccacaaagcagcgacttcacgattgat
gatcaaccatgccacatcgacatcggtggcatgtataacatctacaacgcgctcgccgcc
tttgctgttggccgggcgttcggtgttaccccgactgaaatcagccaagcttttgcttat
gacgagaaggtcttcggtcgtcaagaagtcattcaacttggcaagaaaaaattaaccttg
attttggttaaaaacccagtcggcctcaaccaagtcctcagcatgatcgaaaccgccaag
cagccgtttggttttgcaatgctgcttaatgccaattatgcagatggcattgatactagt
tggatttgggacggcaattttgaagaactcgttgccagtcaaaaggccgccagctatttg
gtcggcggcgaacgctacaaggacatcggtctacgccttacagtcgcaggtgtgcccgaa
aaggcgcttgtcagcaagccagctcttgatgatgtcatcagcaccttaaaacgctccccg
caagatcaactttacgttctggccacctatacagcaatgttgcaactacgcaagaaatta
agcgatggcgggtacatcaaagcaggcttttag

DBGET integrated database retrieval system