KEGG   Lactobacillus casei 12A: LCA12A_2290Help
Entry
LCA12A_2290       CDS       T03665                                 

Definition
(GenBank) ATP-binding component of an ABC superfamily transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lcx  Lactobacillus casei 12A
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcx02000]
    LCA12A_2290
Transporters [BR:lcx02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LCA12A_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_29 Zeta_toxin SbcCD_C AAA_22 AAA_15 AAA_23 MukB
Motif
Other DBs
NCBI-ProteinID: EKQ00333
LinkDB All DBs
Position
941165..942061
Genome map
AA seq 298 aa AA seqDB search
MLEVKDLVKTFGTMTAVDRESFTVKPGEIMGLIGQNGAGKTTTFRMILNFLTPDSGTITW
NGHPLTAKDYDTIGYLPEERGLYPKMRVQDQIIYFARLRGMRTSEIKAKIPEWMDRFQVK
GKPTDKIKDLSKGNQQKVQVIATMIHMPKLVILDEPFSGLDPVNSSLLMAGIQMLKDNGA
AIIYSSHDMANVEAVSDHLVMLKQGRMVLNGAVGEIRESFGRTKLFIESGLTADDLREFD
GVTKIKQHGQEFELTLADPAVGHQIFAKATENGYIPEFRQQPPTLDEIFRLKAGEADA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagtcaaggatcttgtcaagaccttcggcacgatgacggcggttgatcgtgaa
agcttcaccgttaaaccgggtgaaatcatggggttgatcggccaaaatggggcggggaag
acgacaacatttcggatgattttgaattttttgacaccggattctggtaccatcacttgg
aatggtcatccgttaacagctaaagattatgacaccattggatacttaccagaagagcgc
ggtttatatccaaagatgcgggttcaagatcaaattatttattttgcgcgattgcgcggt
atgcgtacgtcagaaattaaagccaagattccagaatggatggaccgatttcaggttaaa
ggcaagcctaccgataaaatcaaagacttaagtaaggggaatcagcagaaagttcaggtc
attgccacaatgattcatatgccaaagctggttattctagatgagcctttttcgggactt
gatccggttaactcaagcctgttgatggctggcattcagatgctgaaagataatggcgct
gcgattatctattccagtcatgatatggctaacgttgaggctgtttccgatcatctggtg
atgctgaaacagggacggatggtcttaaacggagcggttggtgagattcgcgaaagtttt
ggtcggaccaaactattcattgagtcagggttgactgccgatgacttgcgtgaatttgac
ggggtaacgaaaatcaagcagcatggtcaagaatttgagttgaccttagccgatccggca
gttggtcaccagatttttgctaaagcaacggaaaatggctacataccagagttccgtcaa
caaccaccgacacttgatgaaatcttccgtttgaaagcaggtgaagctgatgcataa

DBGET integrated database retrieval system