KEGG   Lactobacillus coryniformis: LC20004_01120Help
Entry
LC20004_01120     CDS       T05341                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lcy  Lactobacillus coryniformis
Brite
KEGG Orthology (KO) [BR:lcy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LC20004_01120
Enzymes [BR:lcy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LC20004_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase Amino_oxidase Thioredoxin_4 Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ATO42602
UniProt: A0A2D1KKL7
LinkDB All DBs
Position
256881..258446
Genome map
AA seq 521 aa AA seqDB search
MAIDATVKQQLVGYLKLLEHDVVITTDLGTDQRSQKVSDFVNEVAALTPRITVVSGKLKR
QPSFALDQAGQASSGIEFAGVPLGHEFTSFVLALLQVSGHAPKISAATKQRITAINTDLH
FETFASLSCHNCPDVVQALNIMSVLNPHISHTMIEGGMYQDEATEKNILAVPTVFLNGEE
WHNGRATLEELVDKAAGAAPQHVASDWTDQQFDVVIVGAGPAAGSAAIYAARKGISTAIV
ADHFGGQPLDTLGIENLAGTNYVEGEQLMANIQAQVEKYGVKVLTGQRVEQIVKNDVVEL
TLAAGDVLKAKTAIIATGAQWKTIGVPGEAEFKNKGVAYCPHCDGPLYAGKDVAVIGGGN
SGIEAAIDLAGICQHVTVLEFAPELGADSVLQAKANAAANITLLTNAATKEITGAGRVNG
LTYTDRATQTEHHLDLEGVFVQIGLVPNTDWVTAPIEVNAHHEIVTDARQATNVDGIFAA
GDCTDSAYKQIIIAMGAGATAALSAFDYLVRTSVKAEKVMA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgcaacagttaagcaacaactagttggttacttaaaattattggagcat
gatgtggtgatcaccaccgatctagggaccgatcagcgctcgcaaaaagtcagtgacttt
gtaaatgaagtcgcagcgttgacgccacggatcaccgttgtcagtggcaaactaaaacgg
caaccaagttttgcgcttgatcaagcgggccaagctagcagcgggatcgaatttgctggg
gtaccattaggacacgaattcacgtcatttgtgctggcgttacttcaggtttccggtcac
gcaccaaaaattagtgcggcgacgaaacagcggatcaccgctattaacacggatttacat
tttgaaacttttgccagtttaagctgccataattgtcctgatgtggtacaagcgctgaat
attatgagcgtgcttaatccacatatcagtcataccatgatcgaaggtggcatgtatcag
gatgaagccacggaaaagaatatcttggctgtgccaacggtctttttgaatggtgaagaa
tggcataatggccgagcaacgttggaagaactagttgataaagctgctggcgctgcaccg
cagcacgttgctagtgattggactgaccaacaatttgatgtcgtgatcgttggtgctggc
ccagcagctggcagtgcagcaatttatgccgcacgtaaagggatctcgacagcaatcgtg
gccgatcattttggcggccaaccactggatacgttgggtatcgaaaacttagctggtacc
aactatgttgaaggtgagcagctgatggccaatattcaagcgcaagttgaaaagtacggc
gtcaaagtactgacaggccaacgggttgaacagatcgtcaaaaatgatgtggtcgaattg
accttggccgctggcgatgtgcttaaagctaaaacagcaatcatcgcaactggtgcgcaa
tggaagactattggcgtgcccggtgaagctgaatttaaaaacaaaggcgtcgcctactgc
ccacattgtgatggtccattatatgccggtaaagacgttgccgtgatcggtggcggtaat
tctggtattgaggcagccattgatttggccggcatttgtcagcatgtgaccgtgcttgaa
tttgcacctgagttaggtgcggatagcgttttgcaggctaaagccaatgcagcagctaac
attacgctgctcaccaacgccgccaccaaagaaatcactggtgcgggccgggttaacggt
ctaacttatacggatcgtgccacccaaacggaacatcatttggatctagaaggggtcttc
gtgcaaattgggttagtaccaaatacggactgggtcactgcgccgatcgaagtcaacgcg
catcatgaaatcgttacggatgcacgccaagcaaccaatgttgacggtatttttgccgcc
ggcgactgcactgattcggcttacaagcagatcatcattgcgatgggcgccggtgcaacc
gcagccttaagcgcttttgactatttggttagaaccagcgttaaagctgaaaaagtcatg
gcgtaa

DBGET integrated database retrieval system