KEGG   Lactobacillus coryniformis: LC20004_11890Help
Entry
LC20004_11890     CDS       T05341                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lcy  Lactobacillus coryniformis
Pathway
lcy00473  D-Alanine metabolism
lcy00550  Peptidoglycan biosynthesis
lcy01100  Metabolic pathways
lcy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LC20004_11890
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LC20004_11890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LC20004_11890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lcy01011]
    LC20004_11890
Enzymes [BR:lcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LC20004_11890
Peptidoglycan biosynthesis and degradation proteins [BR:lcy01011]
 Precursor biosynthesis
  Amino acid ligase
   LC20004_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 RimK CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ATO44559
UniProt: A0A2D1KR58
LinkDB All DBs
Position
complement(2449850..2450881)
Genome map
AA seq 343 aa AA seqDB search
MKIVVLAGGRSPERNVSLSSGAKITNALREKGHAAVLIDLFLGDDLSDVETIAAVFQRPA
PSTDYAISEEVLTNDAIDALRTTDSKGLFGPNVLKICGAADIVFLGLHGEDGENGKVQAT
LDLFGIPYTGSGFAASGITMNKHLAKQLLQHNQINTARYQTIKAGESVPQLAFDFPMVVK
PTHGGSSIGMEIVPDRPALIAALTEAGHFDNEVVVEEYIAGREFSVGVLNGQALPAIEIT
VADGWYDYEHKYQDNGATYQTPPHIPATVHQEMQQMALATMQVLGLTNYGRIDFLWDGQT
IYVIEGNSLPGMTPHSLLPQEAAAVGISYADLCEQIIAGQLDA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgttgtacttgctggcggacgtagccccgaacgcaacgtgtcgctttcatcg
ggcgccaaaatcaccaatgcattacgggaaaaaggccatgctgcagtgttgatcgacttg
tttttaggtgacgatttaagtgacgttgagacgattgcggcggtgtttcaacgcccagca
ccgagtaccgattatgcgatcagcgaggaagttttgacgaatgacgcgatcgatgcttta
cgcaccacagatagtaaaggcttattcgggccgaatgtactaaaaatttgcggtgccgca
gacattgtttttctcggcttacacggtgaggatggcgaaaatggcaaggtccaagcaacc
ttggatctatttggtattccctatactggtagcggtttcgcagcatcggggatcacaatg
aataaacatttagccaaacagttattgcaacataaccagatcaatacggcccgctatcag
acgatcaaagccggtgaatcagtgccacaactggcatttgattttccaatggtggttaaa
ccgactcatggtggttctagtattggcatggaaatcgtgccggatcggcctgcgttgata
gcggctttaactgaagcggggcacttcgataatgaggtggtggttgaggaatatattgct
ggtcgcgaattttcggtgggtgttctcaatgggcaagccttaccggcaatcgagatcacg
gtggccgatggctggtatgattatgaacataaatatcaggataatggcgccacttaccaa
acgccgccgcacattccggctacggtccaccaagaaatgcagcagatggccttggcaacg
atgcaagtgttaggtttgaccaattatgggcgaatcgactttctttgggatggtcagacg
atctatgtgatcgaaggtaactcgctgccggggatgacgccgcattcattattaccgcaa
gaggcggccgcggttggtatcagttatgcggatctatgtgagcagattattgccggccag
cttgacgcgtaa

DBGET integrated database retrieval system