KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0185Help
Entry
Ldb0185           CDS       T00364                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00473  D-Alanine metabolism
ldb00550  Peptidoglycan biosynthesis
ldb01100  Metabolic pathways
ldb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ldb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ldb0185 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ldb0185 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Ldb0185 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ldb01011]
    Ldb0185 (ddl)
Enzymes [BR:ldb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ldb0185 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ldb01011]
 Precursor biosynthesis
  Amino acid ligase
   Ldb0185 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAI97025
UniProt: Q1G7Q5
LinkDB All DBs
Position
154966..156054
Genome map
AA seq 362 aa AA seqDB search
MTKKTQVGLIFGGNSSEYEVSITSAGNIYKAIDKDKFDVHPIWITNSGYVASEADSYKVL
EEPGYMVEKNDKTANLSNLIELASRPELDVLFPIVHGNLGEDGVLQGLFRLIDKPFVGVD
VLAAAVTMDKEFTKILAQRAGVPVAKWVSIKRYEYEDAKNQKLSYDWVSGQLGTSNLFVK
PSNQGSSVGITHVTDDSNYAEALAEAFKYDDKVLVEEGIVGTEVETAVLGNDHPVVSGVG
QIINADNTWYSYENKYSTESTTTLQIPAQIPAETAEKVQENALKIYQITECSGMARVDSM
LRESDGEVIFNELNALPGFTNISMYPKLFEEAGISYPDLITRLIRLAEERYAHKKTLLRK
HD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaacacaagttggtttgatttttggtgggaactcctccgaatacgaagtc
tcaatcacttcagccggcaacatctacaaggcaatcgacaaggacaagtttgacgtgcac
ccgatctggatcacgaactccggctacgtggccagtgaagctgattcatacaaggttctg
gaagagccgggctacatggtggaaaaaaatgacaagacggccaacctttctaacttgatc
gagctggcttcccggccggaactggacgtgctcttcccaatcgtccacggcaacctgggt
gaagacggggtcctgcagggcctcttccgcttgatcgacaagcctttcgtcggggttgac
gttttagcggcagccgtaaccatggacaaggaattcaccaagatcctggcccaaagagcc
ggcgtgccggtagccaagtgggtatctatcaagcgctacgaatatgaggacgccaagaac
caaaagctcagctacgactgggtcagcggccagctgggcaccagcaacctcttcgtcaag
ccgtccaaccagggttcttccgtcggcatcactcacgtaactgacgacagcaactacgct
gaagctttggccgaagcctttaagtacgatgacaaggttttggttgaagaaggaatcgta
ggcactgaagttgaaaccgccgttttgggtaacgaccacccggtagtttccggggtcggc
cagatcatcaacgccgacaatacttggtacagctacgaaaacaagtacagcacagaatca
accacgaccctgcagattccagcccagattccggcagaaaccgcggaaaaggtccaggaa
aacgccttgaagatctaccagatcactgagtgcagcggcatggcccgggttgactccatg
cttagagaaagcgacggggaagtcatcttcaacgaattgaacgccctgccaggctttacc
aacatcagcatgtacccgaagctgtttgaagaagccgggatttcttacccagacttgatc
acccgcttgatcaggctggctgaagagcgctacgcccacaagaagaccctcctgcgcaag
cacgactaa

DBGET integrated database retrieval system