KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1220Help
Entry
Ldb1220           CDS       T00364                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Brite
KEGG Orthology (KO) [BR:ldb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ldb03400]
    Ldb1220
Enzymes [BR:ldb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Ldb1220
DNA repair and recombination proteins [BR:ldb03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Ldb1220
 Prokaryotic Type
    Ldb1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: CAI98022
UniProt: Q1G9Y3
LinkDB All DBs
Position
1032620..1033060
Genome map
AA seq 146 aa AA seqDB search
MDRTEPTTLTNMCMIVDKDRVLTIDREDPVWPGLAFPGGHIEKHESFHDSVIREVKEEAN
LDIVSPRLVGFKQFFDKLDRRYLVFFYRADQFSGSLHASREGKLEWVKINDLPKRQLAYN
FDRDLEVFLKSDLDEHVLLDKKDFLY
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggaccggacggagcctactactttaactaatatgtgcatgatcgtggacaaagaccgg
gttctgacgatcgaccgggaggacccggtttggccaggcctggcttttccaggcggccat
attgaaaagcatgagtcatttcatgattcagtcattcgcgaggtcaaggaagaggccaac
ctggacatagtcagtccccgcctggtcggcttcaagcagttttttgacaagctggaccgg
cgttacctggtcttcttctaccgggccgaccagttctcaggaagtctccacgcttcaagg
gaaggcaaactggaatgggtcaagatcaacgatttacctaagcggcagttagcctacaac
tttgaccgagacctggaagtctttttaaagagtgaccttgatgagcatgtattgttggac
aagaaggactttttatattaa

DBGET integrated database retrieval system