KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1338Help
Entry
LDBND_1338        CDS       T01360                                 

Definition
(GenBank) Serine/threonine protein kinase with beta-lactam (PASTA) domains
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lde01001]
    LDBND_1338
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LDBND_1338
Protein kinases [BR:lde01001]
 Serine/threonine kinases: Other
  Bacterial family
   LDBND_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Haspin_kinase Kinase-like RIO1 Seadorna_VP7 Pkinase_fungal Kdo FTA2 Pox_ser-thr_kin Choline_kinase DUF3446
Motif
Other DBs
NCBI-ProteinID: ADQ61372
LinkDB All DBs
Position
complement(1381224..1383230)
Genome map
AA seq 668 aa AA seqDB search
MINKGYLLGDRYRIVDTLGEGGMANVYLADDIILKRQVAVKIIRLDLQKDSQVLARFQRE
ALATSELSHPNIVSVFDVGTDHGLPYMVMEYVKGPDLKDYIRENSPIPLPQVIKIMDQIL
SAMELAHKHNVIHRDLKPQNILMDEKGNIKIADFGIAVALNQSAITQTNSVLGSVHYMSP
EQTRGGMVTKQSDIYSLGIILYEALTGHVPFNGETPVAIALKHAEDDIPSLRKQNKAIPQ
ALENVVLKATAKDPRDRYASVAEMKADLDSSLDPSRAGEAIYRPSHGNNDETKILPALNG
KVMQAEKAKEGKAEETKKRSFWASIKKYKWWWIGSLFPVFAILLFMFLAVGHNNVRVPDV
VNMTEKAAKTSLKSSGLAVGAVKRTYSSDVKKGKVISTTPKANSPVDKGEKVNLLVSKGP
NLTKVPDVEGLYLSTAKKKLNKLGFKVKSREASSNEYLPGLIISQSVKAGRKVDASKTTI
TLVVAVALEDQPKPSSSSSSKKATFKLADLTGKSLEDAQSYAKSKKLNVKVEKDHSDSVD
SGDVISTDPAAGSEVSEGDTLTITVSKGAEKKEVKKTFTVDYQAAESSSSSSESSSSSSS
SQGNHVRIYIQDDNHSLGNIYRDLYITKDTDFTITFSVTKGDGKIKIVRDDQTVVDETIS
ADDSESGN
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaataaaggttatttgcttggagaccgttaccggatcgtcgacaccctgggtgaa
ggcggaatggccaacgtctacctggctgatgacataattttgaagagacaggtcgccgtt
aaaattattcgccttgatttgcagaaggactcccaggttctggcccgctttcaaagagag
gccctggccaccagtgaactgagccatcctaatattgtctccgtttttgacgtggggacc
gaccatggcctgccatatatggtcatggaatacgtgaagggacctgacttaaaggactat
atccgggaaaacagcccgattcccctcccgcaggtcatcaagatcatggaccagattttg
tcagcgatggaactggcccacaagcacaatgtgattcaccgcgatttgaagccgcagaat
attttgatggatgaaaaaggcaacatcaaaattgctgacttcggtatcgcggtcgccttg
aaccaaagcgcgatcacccagaccaactcggtcctgggttcggtgcactatatgtctcct
gagcagacccggggcgggatggtcaccaagcagtctgacatctattctttggggatcatc
ctgtatgaggccttgactggccatgtgccctttaatggggaaacgccggtggcaattgcc
ctcaagcatgctgaagacgatattccgtcccttagaaagcaaaacaaggccattccccag
gccctggaaaacgttgttttaaaagcgacggccaaggatccgcgggaccggtatgcttcc
gtggctgaaatgaaggcagacctggactccagtctggatccgagccgggcaggcgaagca
atttaccggccaagccacggcaataatgatgaaactaagatcctgccagccttgaacggc
aaggtcatgcaggctgagaaggccaaggaaggcaaggctgaagagacaaagaagcggtct
ttctgggctagtatcaagaaatataagtggtggtggattgggtcattattcccggttttt
gccatcctgctcttcatgtttttggcagttggccataacaatgtccgggtgccggacgtc
gtgaacatgacggagaaggcagccaagacttctttgaagagctcgggcctggcagtaggt
gctgttaagcggacttactccagcgatgttaaaaaaggcaaggtgatttcgaccacgccg
aaggccaacagtcccgttgacaaaggggaaaaggtcaacctgctggtgtctaagggacca
aacttgaccaaggtgcccgatgttgagggcctttatttgtcgaccgccaaaaagaagctg
aacaagctgggcttcaaggtcaagagccgggaggcatcatcaaatgagtacctgccaggc
ttgatcatttcccaaagcgtcaaggccggccgcaaggtagatgcctctaagacaacgatc
actttggtggtggccgtggctttagaagaccagcctaagccttcaagctcctccagcagc
aagaaggcaacttttaaactggccgatctgacaggcaagagcctggaagacgcccagtct
tacgccaagagcaagaagctcaacgtcaaggttgagaaggaccactcggacagcgtggac
agcggtgacgtgatttccactgatcctgccgctggcagcgaggtctctgagggtgatact
ttgacgattacggtctccaagggggctgagaagaaagaggtcaagaagaccttcacggtt
gactaccaggctgcagagagctcatcaagctcaagtgagtcaagctccagctcttcctcc
agccagggcaaccatgtccggatttatatccaggatgacaaccacagtctcggcaatatt
taccgggacctttacatcaccaaggacacggactttacgatcactttttctgttactaag
ggtgacggtaagatcaagattgtccgtgatgaccaaactgtagttgatgagacgatttcg
gcagatgacagtgaaagcgggaattaa

DBGET integrated database retrieval system