KEGG   Leishmania donovani: LDBPK_120580Help
Entry
LDBPK_120580      CDS       T02289                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ldo  Leishmania donovani
Pathway
ldo00220  Arginine biosynthesis
ldo00250  Alanine, aspartate and glutamate metabolism
ldo01100  Metabolic pathways
ldo01200  Carbon metabolism
ldo01210  2-Oxocarboxylic acid metabolism
ldo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LDBPK_120580
   00220 Arginine biosynthesis
    LDBPK_120580
Enzymes [BR:ldo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LDBPK_120580
Amino acid related enzymes [BR:ldo01007]
 Aminotransferase (transaminase)
  Class I
   LDBPK_120580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 13390164
NCBI-ProteinID: XP_003859175
UniProt: E9BB38
LinkDB All DBs
Position
12:342967..344460
Genome map
AA seq 497 aa AA seqDB search
MLRHAARSLSPKQCYISPRVIEAEYAVRGLIPARADEIKADLATGRGSYAFESLVYCNIG
NPQSVGQMPLTFYRQVMALVDAPSLLEDAVIAARLPEDAVARARRYLAEIGTGTGAYTES
FGYRFARAAVAEHINKLDHGVSPAATVNDICLTDGASMGAKLFLQLLVGGASDAVMIPVP
QYPLYSAQIALLGGVKVPYFLHESEGWAMKLPDLVAAYERCVTESGATPRLFVCINPGNP
TGNVLERCVMEDVVRFCHERGMLLLADEVYQENVYDTRRRFLSFREVVLGMPEPYCSETM
LVSLHSTSKGVIGECGRRGGYFCMANLPAALRQQVVKLCSINLCANVNGQLMTALMCSPP
REGETSYAMHQRECDAIFTGMKERAELLARELGNVRGLSCQPVEGAMYAFPRIVLPERYA
QRNEELNAKEGRRLALDARWALELLESSGIVVVPGSGFGQEPGTLHFRITILPPLEQIDR
MVRAIREFQDRIYEQYA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccacgctgctcgcagcttgtcaccaaagcaatgctacataagccctcgcgtc
attgaggcggaatacgccgtgcgggggctgatcccggcgcgcgcagatgagatcaaggcg
gacttggccactggccgcggctcctacgcgttcgaaagccttgtgtactgcaacatcggc
aacccgcagtcggtggggcagatgccgctaacgttctaccgacaagtgatggcgctcgtg
gatgcgccgtccctgctggaagatgcggtaatcgctgcgcggctgccagaggacgccgtt
gcgcgcgcgcgcaggtaccttgcggagattgggacgggtaccggcgcgtacacagagtcg
ttcggctaccggtttgcgcgcgctgccgttgccgagcacattaacaagctcgaccacggc
gtgagccccgctgcgacggtgaacgatatctgtctgacagacggcgcgagcatgggtgcg
aagctgttcctgcagctgcttgtgggcggcgcgagcgacgctgtgatgatcccggttccg
cagtatccgctatactctgctcagattgcgttacttggcggggtgaaggtgccctacttc
ctgcacgagtcggaggggtgggcgatgaagttgccggaccttgttgccgcgtacgagcgg
tgcgtgaccgagagcggcgcgacgccgcgcttgtttgtgtgcatcaaccccgggaacccg
acggggaatgtgctggagcgctgcgtgatggaggacgtcgtgcgtttctgccacgagcgc
ggcatgctgctgcttgcggacgaggtgtaccaggagaacgtgtatgacacacggcgccgg
tttttgagctttcgcgaggtggtacttgggatgcctgagccgtactgctcggagacgatg
cttgtgtcgctgcactcgacatcaaaaggagtgattggtgaatgcgggcggcgcggcggg
tatttctgcatggcgaacctgcctgctgcgctgcgccagcaggttgtgaaactgtgctcg
atcaacctgtgtgcaaatgtaaacgggcagttgatgactgcgctgatgtgctcgccgccg
cgcgaaggcgaaacgagctacgcgatgcaccagcgcgagtgcgacgcgatctttacgggc
atgaaggagcgcgctgagctgctggcgcgcgagcttgggaatgtgcgcgggctctcgtgc
cagccggtggagggcgcgatgtacgcgttcccgagaattgtgttgcctgagcggtacgcc
cagcggaacgaggagctgaacgcgaaggagggtcggcggcttgcgctggacgcgcggtgg
gcgctggagctgctggagtcgagcgggatcgttgttgtgcccgggtctgggttcgggcag
gaacccgggacgctgcacttccggataacgattctcccgcctcttgaacagatcgatcgg
atggtgcgtgcaatccgcgagttccaggaccggatctacgagcagtacgcgtaa

DBGET integrated database retrieval system