KEGG   Leishmania donovani: LDBPK_241700Help
Entry
LDBPK_241700      CDS       T02289                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ldo  Leishmania donovani
Pathway
ldo00020  Citrate cycle (TCA cycle)
ldo00190  Oxidative phosphorylation
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LDBPK_241700
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LDBPK_241700
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LDBPK_241700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 13391182
NCBI-ProteinID: XP_003861260
UniProt: E9BH32 A0A3Q8ID36
LinkDB All DBs
Position
24:645027..646850
Genome map
AA seq 607 aa AA seqDB search
MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLIMEDGCCRGVMAMSIDDGTIHRFKSKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVA
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVISPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPELRADAGEASIADLDRILNNKGDIPIARIRERMKETM
ALYAAVFRTEESMQTGKKIIEECYRDFSHAFVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYQERDDHNWMKHTLAYLDDAKGKVRLAYRPVHMEMLTNEVESI
PPAKRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcacctttacgcgtcttgcccttagccgcgcctacccggtcatcgaccac
acgtacgactgcgtcgtcgtgggcgccggtggctctggtctccgcgcggccatgggtgtg
gcggcctctggctacgatgtggcgtgcatctcgaagctgtacccgtctcgctcgcacacg
atagcggcacagggtggcattaacgctgctctcgccaactgcgaggaggatgactggcgc
tggcatgtgtacgacacagtaaaaggctcggactggctcggtgaccaggatgcaatccag
tacatgtgccaggaggccccgtgcgttgtgtcggagctggaaagcatgggtctgcccttc
ctgcgcacaaaggacggcttcatctaccagcgcgcctttggtggtcagtcgatccactac
ggtggcaagcaggcgcgccgtacctgtgcggcgtcggaccgcacgggccacgccatgctt
cacaccctgtacggccagtccttccaatacggcgtgaacttctacaacgaatactactgc
cttgatctaatcatggaggatggctgctgccgcggtgtgatggccatgagcatcgacgat
ggtacgatccaccgcttcaaatcgaagtacacagtgctctgcacgggtggctacggccgc
gtgtacttcacgacgacaagcgcgaagagctgcacgggcgacggcacggccatggtggcg
cgcgccggcctgccggcggaggacatggagtttgtgcaattccatcccaccggcatctac
ggccctggcgtgctcatcactgagggcgcgcgcggcgagggtggctaccttgtgaacagc
gagggtgagcgcttcatggagcgctacgcccccaaggcgaaggatctggcgtcgcgcgat
gtcgtgtcccgggccattacgatggagattctggcggggcgcggctgcggccccaagaag
gaccacgtgatgctgcagctacaccacctcgaccctgccactctgcataagaagctgccg
ggcatctcagagagcgctcacatcttcgccggcgttgacgtgaccaaggagccgattccg
attgtgccaacggtgcactactcaatgggcggcgtgccgacactgtggacgggcgaggtg
atcagcccgcgcaacggtgacgacaacgcgatcgtgcccggcctgctcgcagctggtgag
tgcgcctgcgctagcgtgcacggcgccaaccgcctcggcgcgaactcgctgctggacatt
gtcgtgttcggcaagtcgtgcgccaacacggtcatctttaatctgacgaaggagggccgc
aagcagcccgagctgcgcgccgacgccggcgaggcctcgatcgccgatctggaccgcatc
ctcaataacaagggcgacattcccatcgcccgtatccgtgagcgtatgaaggagacgatg
gcactctacgccgccgtattccgcacagaggagagcatgcaaacaggaaaaaagataatc
gaggagtgctaccgagacttctctcacgccttcgtgcacgacaaatcaccggtgtggaac
agcaacctcattgaggcgctcgagctgcgtaacctgctgacgaacgccatgatgacgatt
agcggcgctgtggtgcgcaaggagagccgcggtgcccacgcacgtgacgactaccaagag
cgtgacgaccacaactggatgaagcacaccctcgcatacctcgacgacgccaagggcaag
gtgcgccttgcgtaccgcccggtgcacatggagatgctgacgaatgaggtggagagcatc
ccgccggcgaagcgagtgtactag

DBGET integrated database retrieval system