KEGG   Leuconostoc sp. C2: LGMK_00530Help
Entry
LGMK_00530        CDS       T01567                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lec  Leuconostoc sp. C2
Brite
KEGG Orthology (KO) [BR:lec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lec01001]
    LGMK_00530
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LGMK_00530
Protein kinases [BR:lec01001]
 Serine/threonine kinases: Other
  Bacterial family
   LGMK_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo RIO1 Kinase-like APH Haspin_kinase Pkinase_fungal Seadorna_VP7 PIP49_C FTA2 HTH_38 LEM
Motif
Other DBs
NCBI-ProteinID: AEJ30170
LinkDB All DBs
Position
114822..116753
Genome map
AA seq 643 aa AA seqDB search
MLPDTVIDNRYKIIKSLGGGGMANVYLAHDEFLDRDVTFKMMRLDMKNDADLAKRFQREA
VSATELVHDNIVQVYDTGEYEGSQYLVMEYVAGDDLKSYIAQHFPIPYQQVVDIMIQILS
AVQAAHDAGIIHRDLKPQNILINEQAQVKITDFGIAIAKSVQDMTQTNTVIGSVHYLSPE
QTRGGMASAKSDIYALGVMLYEMLTKQVPYEGDTPVAVAMKHATADMPSVRDFDPRIPQA
LENVILKSTAKRPQDRYLGAAAMSEDLQTALSPRRSDETRFAPMSETTDETRIIPMAQIQ
DQLKTGVSSDKIFPDEVPEEPSVQETIITYGKKGYAIKDIARKVDRTPNFVRNVLQENGI
KFRKSPKWPWAILGMLILIAATLIFLNYQSNKVTVPDVTNLTQDQATTRIKKAGLTVGTI
SSTTSKRVAKGKVVRSTQSSGSEAKKGDAINLIISSGRAKVRFGDYVGSDYTMAAAQLRA
QGYSVNRKDSASDNVAEGKIMLQSIDANDKVDPISTTVDFTVSTGAVKITVPDFTSKGTQ
EQVQNWASQNDIVVNFNTQYDGNTKKDHVISQSIRGGSSITKDMVLLVTISQGPQQSSSD
SSDDEDTSSDSDSSSSKNNSSSNSSSSKNSSSTDSSSSSSDKE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttaccagatacagtgatagacaatcgttataaaattatcaaatcgcttggtggcggg
ggcatggccaacgtttatttggcgcatgatgaatttttagaccgagatgtcacctttaaa
atgatgcgactggatatgaaaaatgacgctgatctagcgaaacgctttcaacgggaggca
gtttctgcaacagaattagtacatgataatattgttcaagtatacgatactggcgaatac
gaggggtcacaatatttggtgatggagtatgttgcgggggatgatttaaagtcctatatt
gcgcaacattttccaattccttatcaacaggttgttgatatcatgatacaaattttaagt
gcagttcaagcagctcatgatgcgggcattattcatcgagatttaaagccacaaaatatt
ttaatcaatgaacaagcacaagttaaaattactgactttggtattgccattgctaaatca
gtacaggacatgacacaaacaaatactgtgattggttcggttcattatttatctcctgaa
caaacacgtggcggaatggcttcagcaaaatcagacatctatgcacttggtgtcatgtta
tacgaaatgctgactaaacaggtgccttacgaaggggatacgccagttgcagtggcgatg
aagcatgcaacggcagatatgccatctgttcgtgattttgacccacgaatacctcaggct
ttagaaaatgtgattttaaaatcaacggctaagcgaccacaagatcgctatctgggtgca
gctgctatgtctgaggaccttcaaacagcattatcgcccagacgttccgatgagacgcgt
tttgcacctatgtctgaaacgacagacgaaacacgtatcattcccatggcacaaattcaa
gatcaacttaaaacaggtgtttcttcagataaaatttttccagatgaggtacctgaagag
ccctcagttcaagaaacaattattacttatggaaaaaaaggctatgcgattaaagatata
gcacgtaaagttgatcgtacacccaactttgttcgtaatgtgctgcaagaaaacggtatt
aagtttcgtaaatcgccaaaatggccatgggcaattttgggtatgttgattctgattgcg
gcaacgttgattttccttaattatcaatccaataaggtaaccgtgccagatgtcactaat
ttaacacaagaccaagcaacgacaaggattaaaaaagcaggactgacggtgggaacaatt
agttcaacgacgtcaaagcgtgttgcaaagggaaaagttgtccgttccacacaaagtagt
ggatcagaggcgaaaaagggggatgctattaaccttattatctcttctggacgtgctaaa
gtacgttttggtgattatgttgggtcagactatacgatggctgcagcgcagttgagagca
caaggctattctgttaacaggaaagatagtgcctctgataatgttgctgagggcaaaatt
atgttacaatcgattgatgcaaatgataaggtagatccaatatcaactacggttgatttt
acagtctctaccggtgcagtcaaaattactgttcctgactttacaagtaaaggaacgcaa
gaacaggtacaaaattgggctagccaaaacgacattgttgttaattttaatacccaatat
gatggtaatactaaaaaagaccatgtaatcagtcaatcaattcgtggtggatctagtatc
accaaagatatggttttgttggtcactatttctcagggaccacagcaatcttcaagtgat
agttctgatgatgaagatacatctagtgatagtgattcatcctcatctaagaataattcc
agttcaaattcatcttcatcaaaaaatagttcaagtactgactcctcatcaagtagtagt
gataaagaataa

DBGET integrated database retrieval system