KEGG   Leuconostoc sp. C2: LGMK_04845Help
Entry
LGMK_04845        CDS       T01567                                 

Definition
(GenBank) Glycosyltransferase, involved in cell wall biogenesis
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00500  Starch and sucrose metabolism
lec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LGMK_04845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lec01003]
    LGMK_04845
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lec02000]
    LGMK_04845
Enzymes [BR:lec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     LGMK_04845
Glycosyltransferases [BR:lec01003]
 Polysaccharide
  Structural polysaccharide
   LGMK_04845
Transporters [BR:lec02000]
 Other Transporters
  Others
   LGMK_04845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AEJ31027
LinkDB All DBs
Position
complement(998903..1000819)
Genome map
AA seq 638 aa AA seqDB search
MWKLKKIYYVGAIVCSMIYIVWRGLFTLPWEQSFLELSYGLLLWLSEILSIFTAFVLIWN
KKTWKQPQQPDIVSKDIFPDVDILIATHNESASLLYKTINACTFLEYPDKHKIHIYLCDD
KNRPEMKELAEQFKINYIGLLENRHAKAGNFNYALKHSQSPLVATFDADMIPYSNFLMAT
VPYFFKRYATLTRKKVGFVQTPQSFYNEDIFQHNLYANRAIPNEQDFFSREVNVLNSYHD
SAIYTGSNTLFLRTAIVAAGGFPTNTLTEDFQLGAQINSCGYDSISTTDPMASGLTPTDA
KSIFKQRTRWARGMIQSIKNLHLLSNKGLSWSQKIIYLNGYLYWWSFLGRLLFVFAPILF
ALFDFRVVNTNFWLLLIFWIPGYGLLTFVKHDLSGNITNQRWGEVQELFFAPYLILPVIL
ETIGIKNNQFKVTQKNGDDSKKDILYAIPHIVILLLTIVSLIKFNYGKFGSEILYGSVIT
FWLLNNLINAFFAVLLFVGKPKQAVQTFHVSGIVEMSVSKKYQKIELCYLTESTVRIKLS
ADMSLVPEKSYEMTIITSCYTAHVHAYVQEQYGTNDFLMAIESIDEANERQLLQMLHDGF
NKQLPLERNQWLTTFDLLFDNINRRLRILNRIGKGRGK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaacttaaaaaaatttactatgttggggcaattgtatgttcaatgatatacatt
gtgtggcgtggactgtttacattaccttgggaacagtcatttcttgaattgagctatggc
ttgttgttatggttgagtgaaattttgtcaattttcacggcttttgtgttaatttggaat
aaaaaaacgtggaaacaacctcagcaacctgatattgtttccaaggatatatttccagat
gttgatattttaatagcgacacataatgaaagtgcatcattgctgtacaaaacaattaat
gcgtgtacttttctagaatatccagataaacataaaatacatatttatttatgtgatgat
aagaatcgccctgaaatgaaagagctagcagagcaattcaaaattaattatattgggtta
ctagagaataggcatgctaaagcgggtaattttaattatgcgttaaagcatagccaatca
cctttagttgcgacatttgatgctgatatgataccctattctaattttttgatggcaact
gttccttacttttttaaacgttatgccacgttgacaaggaaaaaagtgggtttcgttcaa
acacctcagagtttttacaatgaagatattttccaacataacttatacgctaatcgtgcg
attcccaatgagcaagattttttttctagggaagtcaacgttttaaactcatatcatgat
agtgcgatttatacaggctcgaacacattatttttaaggacggctattgtcgcagctggt
gggtttcctacaaacacattgacagaagattttcaacttggtgcacaaattaacagttgt
ggttatgatagcatttccactactgatcccatggcgagtggcttaacaccgacagatgct
aaaagtatctttaaacaacgcacaagatgggcgcgtggcatgattcaaagcattaagaat
ttgcatctactatctaataaaggtttatcttggtcgcaaaaaatcatttatttgaatggc
tatttatattggtggtcatttctaggccgattactattcgtttttgcaccgattttattt
gccttgtttgattttagagtggttaacacgaatttttggttattattaatattttggata
ccaggatatggcttattaacatttgtcaaacatgatttgtctgggaacatcactaatcag
cgttggggagaagtacaagaacttttttttgcaccataccttattttgccagtgattttg
gaaacaattggtattaaaaataatcaattcaaagtgactcaaaaaaatggtgacgatagc
aaaaaagatatcttatatgctataccacacattgttattttattgttaacaatcgtgagt
ttgattaaatttaattatggtaagtttgggtcagagatactttatggtagtgtgattaca
ttttggttattaaataatctgattaatgctttttttgctgtgttactgtttgttgggaag
ccgaagcaggcggtacaaacttttcatgtttcaggtattgttgaaatgagtgtttcaaag
aaatatcagaagatagaactttgctatttaactgaatcaacagtacgtattaagttgtca
gctgatatgagtctggtacccgaaaaaagttacgagatgacaattataacatcttgctat
acagctcatgttcatgcatacgtacaagaacagtatgggactaatgattttttaatggct
atcgagtcaattgatgaagcaaatgagcggcaacttttgcagatgctgcatgatggtttt
aataaacaattaccgctagaaagaaatcaatggctgacaacgtttgatttgctatttgat
aatataaatcgtcgcttgcgcattcttaatcgaataggaaagggtcgtggaaaataa

DBGET integrated database retrieval system