KEGG   Leuconostoc sp. C2: LGMK_07690Help
Entry
LGMK_07690        CDS       T01567                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00473  D-Alanine metabolism
lec00550  Peptidoglycan biosynthesis
lec01100  Metabolic pathways
lec01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LGMK_07690 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LGMK_07690 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LGMK_07690 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lec01011]
    LGMK_07690 (ddl)
Enzymes [BR:lec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LGMK_07690 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lec01011]
 Precursor biosynthesis
  Amino acid ligase
   LGMK_07690 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEJ31587
LinkDB All DBs
Position
complement(1549803..1550936)
Genome map
AA seq 377 aa AA seqDB search
MNKKHVALLFGGNSSEHDVSKRSAQNFYDAIMATGKYDVTVFAIAQNGYFLDPESSKKIL
ALADEQPIVDAYMAKVDTSDPLARINALRNGGDFDIFFPVVHGNLGEDGTLQGLFRLLNK
PYVGAPLRGHAVSFDKVLTKELLTVNHIRNTNYIVIDTETAKDWTWDKITNELGSVVFVK
AANQGSSVGISRVKNAVEFETALADSFQYDYKVLIEQAVKGPRELEVGVIGNEEPIVSEI
GAHTVPEQGEGDGWYDYNNKFVDNSAVYFEIPAQLPKEVTEEVKAMAIKSYKVLNLRGEA
RMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDIDNAKLVDMMITYGFEEFEKNAQ
LSYKFVTLGEEKIGKFN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaacatgtggctttattatttggcggtaattcatcagaacacgacgtatca
aaacgttctgctcaaaatttttatgatgcgattatggcaacaggaaaatatgatgtaaca
gttttcgctattgcacaaaacggttattttttggaccctgaaagttctaaaaaaatatta
gcgttggctgatgagcaaccgattgtggatgcttatatggctaaagtagacactagtgac
ccgttggcgcgcattaatgctttgcgtaacggcggtgattttgatatattcttcccagtt
gttcatggtaatttaggtgaagatgggacattgcaggggctgtttaggttattaaacaaa
ccatatgttggggctcctttgcgtgggcatgcggttagttttgacaaagttttaactaaa
gaattgttaaccgttaatcacattcgtaataccaattacatagtaattgatactgagaca
gctaaggattggacttgggataaaataaccaatgaactaggttcagttgtatttgtcaag
gcggctaatcaagggtcatctgttggtatttcacgggtcaaaaacgcagtagaatttgaa
acggcattagcagattcattccaatacgattacaaagttttgattgaacaggctgttaaa
ggaccacgagaattagaagtgggtgttattggtaacgaagagccaatcgtatcagaaatt
ggggcacacactgttcctgaacagggtgaaggtgatggctggtatgattacaataataag
tttgtcgacaattcagcagtttacttcgaaattcctgctcagctaccaaaagaggtaaca
gaagaagtcaaggcaatggctatcaagtcttataaagtcttaaatttacgtggtgaagca
cgtatggactttttgttagatgaaaataatgtgccatatcttggtgagccaaacacatta
cctgggtttaccaatatgtcgctctttaagcgattatgggactattcagatattgataat
gcaaagcttgttgacatgatgatcacatatggctttgaagaatttgaaaagaacgcacaa
ttgagctataaatttgtgactttgggcgaagaaaagatagggaaatttaactaa

DBGET integrated database retrieval system