KEGG   Lentzea guizhouensis: BBK82_09640
Entry
BBK82_09640       CDS       T04448                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
led  Lentzea guizhouensis
Pathway
led00300  Lysine biosynthesis
led01100  Metabolic pathways
led01120  Microbial metabolism in diverse environments
led01230  Biosynthesis of amino acids
Module
led_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BBK82_09640
Enzymes [BR:led01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     BBK82_09640
SSDB
Motif
Pfam: THDPS_M Hexapep_2 Hexapep
Other DBs
NCBI-ProteinID: ANZ36287
UniProt: A0A1B2HF09
LinkDB
Position
1920929..1921885
AA seq 318 aa
MSTAYGIGLATVTPDGTVLDTWYPSPVLEETPDLGTIRLSSADIAAALGEPAAKLLGEDP
EREVEVVGVRVAVDLEAAPADTYDVWLRLHLLSHRLIQPHGANLDGVFGLLTNVVWTNHG
PCAVDGFEQTRARLRGRGPVTVYGVDKFPRMVDYVVPSGVRIGDADRVRLGAHLASGTTV
MHEGFVNFNAGTLGSSMVEGRISGGVVVGDGSDVGGGASIMGTLSGGGKQVISIGERNLL
GANAGLGISLGDDCVVEAGLYITAGTKVTLPDGTVTKAVELSGQSNLLFIRDSTDGVVKV
KPRKGTGVELNAALHAND
NT seq 957 nt   +upstreamnt  +downstreamnt
gtgagcaccgcatacggcatcggcttggccactgtgaccccggacggcaccgtcctcgac
acctggtacccgtcgcccgtcctcgaggagacgccggacctgggcacgatccggctgtcg
tccgccgacatcgcggcagcgctgggcgagcccgccgccaagctcctcggtgaggacccg
gagcgcgaggtcgaggtcgtcggcgtgcgcgtggccgtggacctggaggccgccccggcc
gacacctacgacgtctggctgcggctgcacctgctcagccaccggttgatccagccgcac
ggcgcgaacctcgacggcgtcttcggcctgctcaccaatgtcgtgtggacgaaccacggc
ccgtgcgcggtcgacggcttcgagcagacccgcgcccgcctgcgcggccgcggtccggtg
accgtctacggcgtcgacaagttcccgcgcatggtcgactacgtcgtcccgtccggtgtc
cgcatcggcgacgcggaccgggtgcgcctcggtgcccacctcgcgtccggcacgacggtc
atgcacgagggcttcgtgaacttcaacgccggcacgctcggcagctcgatggtcgagggc
cgcatctccggcggtgtcgtggtcggtgacggctccgacgtcggcggcggcgcgtcgatc
atgggcacgctgtccggtggcggcaagcaggtcatctcgatcggcgagcggaacctgctg
ggcgcgaacgccggtctgggcatctcgctcggcgacgactgcgtggtcgaggcgggcctc
tacatcaccgccggcacgaaggtgacgttgccggacggcacggtcaccaaggccgtggag
ctcagcggccagtcgaacctgctgttcatccgggactccacggacggcgtggtgaaggtc
aagccgcgcaagggcaccggcgtcgagctcaacgccgccctgcacgcgaacgactga

DBGET integrated database retrieval system