KEGG   Lentzea guizhouensis: BBK82_10900Help
Entry
BBK82_10900       CDS       T04448                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
led  Lentzea guizhouensis
Pathway
led00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BBK82_10900
Enzymes [BR:led01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBK82_10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ANZ36501
UniProt: A0A1B2HFN0
LinkDB All DBs
Position
complement(2176672..2178633)
Genome map
AA seq 653 aa AA seqDB search
MPGLGWGADYNPEQWPEHVWAEDVELMRRAGVNLVSVGIFSWAKIEVSKGEYRFEWLDRV
LDLLHDNGIRVDLATATAAPPPWLTTEHPEMLPVRADGVRLSHGSRQAYCPSSPIYRDRA
TALAAEMAAHYRDHPALAAWHVGNEYACHVKRCYCDTCAASFREWLASRYTLEQLNDAWS
TAFWSQGYTDFAQVLPPRVTPTFSNPAHVLDYDRFSDDAILELYKAERDVLRMITPDVPI
TTNFMANWTFGDLDYWKWAREVDFVSNDHYTEAQSPDRHVELAMSADLVRGLAGGKPWLL
MENSTSAVNWQRRNIAKLPGEMRRHSYQNIARGADGTLFFQWRQSRGGSERFHSAMVPHA
GPDTKVYREVCQVGAEYARIADVVGSTVDASVAVLYDFQSAWALRQDAHPTNDFDHYRHV
LGYYKALWQAGVTVDFVAPGTNLSKYALVVVPAFYAVSDAHAAVVADYVAGGGHVVVTYL
SGVADEYTRVRLGGYPGAFRDVLGVWSEEFHPLREGETVSLTDGSTCSLWTEHLHVRGAD
IVASYADGPLPGVPAVTRNAFGNGVAWYVACDLDEDGLGRTVESALSGAGVAVSTSGIEL
VRRHGDVSWLFAVNHTDTDAEIEASGVDVVSGTQVSGRLTVRAGDVVVLREEV
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcctcggctggggtgccgactacaacccagagcagtggcccgaacacgtctgg
gccgaggacgtcgagctcatgcggcgggccggggtgaacctcgtcagcgtcgggatcttc
tcctgggcgaagatcgaggtgagcaagggcgagtaccggttcgagtggctcgaccgggtg
ctcgacctgctgcacgacaacggcatcagggtcgacctcgcgaccgccaccgccgcgccg
ccgccgtggctcaccaccgagcaccccgagatgctgcccgtccgcgcggacggcgtgcgg
ctctcgcacggctcccggcaggcgtactgcccgtcgtcgccgatctaccgcgaccgggcg
accgcgctggccgccgagatggccgcgcactaccgcgaccacccggcgctggccgcgtgg
cacgtcggcaacgagtacgcgtgtcacgtgaagcgctgctactgcgacacgtgcgccgcg
tcgttccgcgagtggctggcgagccgctacacgctcgagcagctcaacgacgcctggtcc
acggcgttctggagccagggctacaccgacttcgcgcaggtcctgccgccgcgcgtgacg
ccgacgttctccaacccggcgcacgtgctcgactacgaccggttctccgacgacgcgatc
ctcgagctctacaaggccgagcgcgacgtgctgcggatgatcacgcccgacgtgccgatc
accacgaacttcatggcgaactggacgttcggtgacctcgactactggaagtgggcgcgc
gaggtcgacttcgtctcgaacgaccactacaccgaggcccagtcgcccgaccggcacgtc
gagctcgcgatgtccgccgacctggtgcgcggcctcgcgggcggcaagccgtggctgctg
atggagaactcgacgtccgcggtgaactggcagcggcgcaacatcgccaagctgccgggg
gagatgcggcggcactcgtaccagaacatcgcccgcggcgcggacggcacgctgttcttc
cagtggcggcagtcgcgcggtggcagcgagcgcttccactcggcgatggtcccgcacgcg
ggcccggacaccaaggtgtaccgcgaggtctgccaggtcggtgccgagtacgcgcggatc
gccgacgtcgtcggttccactgtggacgcctcggtcgcggtcctgtacgacttccagtcc
gcgtgggcgctgcggcaggacgcccacccgaccaacgacttcgaccattaccggcacgtg
ctgggctactacaaggcgttgtggcaggcgggggtcacggtcgacttcgtcgcgcccggc
acgaacctgtccaagtacgcgctggtcgtggtgccggcgttctacgcggtgtccgacgcg
cacgccgcggtggtcgcggactacgtggccggcggcggtcatgtcgtggtcacgtacctg
tccggagtcgccgacgagtacacgcgagtgcgactgggcggctaccccggtgcgttccgc
gacgtgctgggcgtgtggtccgaggagttccacccgctgcgggagggcgaaaccgtctcg
ctgaccgacgggtcgacctgctcgttgtggacggagcacctgcacgtccgcggcgctgac
atcgttgcctcctatgccgatggcccgctgccgggtgtgcccgcggtgacgcgaaacgct
ttcggaaacggcgtcgcgtggtacgtggcgtgcgacctcgacgaggacggtctcggccga
acggtggaaagcgcgctttccggtgcgggcgttgcggtgtcgaccagcgggatcgagctc
gtgcggcggcacggggacgtatcgtggctcttcgccgtcaaccacaccgacaccgacgcg
gagatcgaggcgtccggtgtcgacgtggtgtccggcacgcaggtctccggacgcctcacc
gtgcgagccggggacgtcgtcgtcctcagggaagaggtgtga

DBGET integrated database retrieval system