KEGG   Lentzea guizhouensis: BBK82_14405Help
Entry
BBK82_14405       CDS       T04448                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
led  Lentzea guizhouensis
Brite
KEGG Orthology (KO) [BR:led00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:led01001]
    BBK82_14405
Enzymes [BR:led01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBK82_14405
Protein kinases [BR:led01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBK82_14405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal RIO1 Kdo DUF3394 DUF4448 Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: ANZ37082
UniProt: A0A1B2HHA8
LinkDB All DBs
Position
2877530..2879533
Genome map
AA seq 667 aa AA seqDB search
MSTPRLLSNRYELGETLGYGGMSEVHKGRDVRLGRDVAIKVLRADLARDAQFQERFRREA
QNSAALNHPAIVAVYDTGETQTEYGPLPYIVMEFVDGRTLRDIVKTQGPLSGKRAMEVMA
DVSAALDFSHRHGIVHRDVKPANVMITKSGAVKVMDFGIARALHDGQAAVTQTAAVIGTA
QYLSPEQARGESVDARSDVYAAGCVLFELLTGEPPFTGDSPVAVAYQHVREDPKAPSSLN
PKVSPQLDAIVLKAMAKGPANRYQSAAEMRADLVRVLSGQRPSAPAVMTAEDRTAVMNEQ
ARAPRTQTINGGGRHRPAALKSEPDDDYDPVADEEDDRRAKRKKTIMIALVVVLCIAVLG
LAAWITTSLMNSSGSDDPQKVSVPAVVGMEPLLANDKLTQAGLKPKQELVPCEPGPNGAA
AACTAEQIGKVLGTNPTEGTTLVKGTEVLVRVGSPPGEGTVPDLTGKSPTEAQQILDKDP
NGFKVQQSDQLIETDEAAKVGKVVQQNPSVGLKLKKGGTITISLGKAPDKQNVPGVVGDD
VNDARQTLEGSGFKVNVQPVDSAKPLNEVLKQDPAPNTKAAKDTTVTLQVSKGNLFEMPD
LTGLSAKDAEARLRQLGWNGNFNEDDQQVSNPQQDKKVIGQSVQKGQAITKGQAITVNVG
KFGIITS
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccgcgactgctctcaaaccgctacgaactgggtgagaccctcggctacggt
ggcatgtccgaggttcacaaagggcgggacgtccggctcggcagagacgtggcgatcaag
gtgctgcgcgctgacctcgcccgcgacgcccagttccaggagcggttccggcgggaggcg
cagaactcggcagctctgaaccacccggcgatcgtcgccgtctacgacaccggcgagacg
cagaccgagtacggcccgctgccctacatcgtgatggagttcgtcgacgggcggacgttg
cgcgacatcgtgaagacgcagggcccgctgtcgggcaagcgcgcgatggaggtcatggcc
gacgtctcggccgcgctcgacttcagccaccggcacggcatcgtccaccgcgacgtgaag
ccggccaacgtgatgatcaccaagtccggcgccgtgaaggtgatggactttggcatcgcc
cgtgccctgcacgacggtcaggccgcggtcacccagaccgccgcggtgatcggcacggcc
cagtacctgtcgccggagcaggcgcgcggtgagtccgtcgacgcgcgttccgacgtctac
gcggccggctgcgtgctgttcgagctgctgaccggtgagccgccgttcaccggtgactcc
cccgtcgccgtcgcctaccagcacgtgcgggaggacccgaaggccccgtcgtcgctgaac
ccgaaggtgtcgccgcagctcgacgcgatcgtgctgaaggcgatggcgaagggcccggcg
aaccgctaccagtcggccgccgagatgcgtgcggacctggtgcgcgtgctgtccggccag
cgcccgtccgccccggccgtgatgacggccgaggaccgcacggccgtgatgaacgagcag
gcccgcgccccgcgcacgcagacgatcaacggcggcggtcggcaccgtcccgcggcgttg
aagtcggagccggacgacgactacgacccggtcgcggacgaggaagacgaccgccgcgcc
aagcgcaagaagaccatcatgatcgcgttggtggtcgtcctgtgcatcgccgtgctcggc
ctggccgcgtggatcaccaccagcctgatgaactcctccggcagcgacgacccccagaag
gtgtccgtgcccgcggtcgtcggcatggagccgttgctggccaacgacaagctcacccag
gccggtctgaagccgaagcaggagctcgtcccctgcgagccgggcccgaacggtgcggcc
gcggcgtgcacggccgagcagatcggcaaggtcctgggcacgaacccgaccgagggcacc
acgctcgtcaagggcaccgaggtcctcgtccgggtgggctcgccgcccggtgagggcacc
gtgcccgacctgaccggcaagtcgccgaccgaggcccagcagatcctggacaaggacccg
aacggcttcaaggtgcagcagagcgaccagttgatcgagaccgacgaggccgccaaggtc
ggcaaggtcgtgcagcagaacccgtcggtcggcctgaagctgaagaagggtggcacgatc
accatcagcctcggcaaggcaccggacaagcagaacgtgcccggtgtggtcggtgacgac
gtgaacgacgcgcggcagaccctcgaaggctccggcttcaaggtcaacgtgcagccggtg
gacagcgcgaagccgctgaacgaggtcctcaagcaggacccggcgccgaacaccaaggca
gccaaggacaccacggtcacgttgcaggtctcgaagggcaacctgttcgagatgcccgac
ctgaccggcctgtccgcgaaggacgccgaggcccggctgcgccagctcggctggaacggc
aacttcaacgaggacgaccagcaggtgagcaacccgcagcaggacaagaaggtcatcggc
cagtccgtgcagaagggtcaggccatcaccaagggccaggcgatcacggtgaacgtcggc
aagttcggcatcatcacgagctag

DBGET integrated database retrieval system