KEGG   Lentzea guizhouensis: BBK82_14560Help
Entry
BBK82_14560       CDS       T04448                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
led  Lentzea guizhouensis
Pathway
led00473  D-Alanine metabolism
led00550  Peptidoglycan biosynthesis
led01100  Metabolic pathways
led01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBK82_14560
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBK82_14560
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BBK82_14560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:led01011]
    BBK82_14560
Enzymes [BR:led01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BBK82_14560
Peptidoglycan biosynthesis and degradation proteins [BR:led01011]
 Precursor biosynthesis
  Amino acid ligase
   BBK82_14560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: ANZ37103
UniProt: A0A1B2HHA2
LinkDB All DBs
Position
complement(2908468..2909412)
Genome map
AA seq 314 aa AA seqDB search
MADRVVAVLSGGLSHEREVSIRSGRRLSAALRSVGVTVEEWDADASLLTRLQDDRPDAVV
VALHGGEGENGSVQAILEMLGVPYVGTDSRACRRAWDKPTAKAELARAGLATPEWVVLPH
ATFRELGARPVLDAMVSTLGLPMMLKPDQGGSALGAQVVRDAAELPPAMVGCLAYGDTVL
AEQFISGVEVAVAVVDGPDGPTALPAVEIVPETGVYDYTARYTAGLTDFHAPARLDAAAA
KAVGELAVAAHRLLGLRDVSRTDAVVAEDGTVYFLEVNVSPGLTETSLLPMAVEAAGQSL
GEIYAGLIERAVAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaccgcgtggtcgctgtgctgtccggtgggctctcccacgaacgcgaggtctcg
atccgctcgggtcgccggctgtcggccgccctgcggtcggtgggtgtgaccgtggaggag
tgggacgccgacgcctcgttgctgacgcggttgcaggacgaccgtccggacgccgtcgtc
gtggcgttgcacggtggtgagggcgagaacggttcggtgcaggcgatcctcgagatgctc
ggggtgccgtacgtgggcaccgactcgcgcgcgtgccgccgggcgtgggacaagccgacc
gcgaaggccgagctggcccgtgccgggctcgcgacgccggagtgggtcgtcctgccgcac
gcgacgttccgggagctcggcgctcgccctgtgctggacgcgatggtctcgacgctcggt
ttgccgatgatgttgaagccggaccagggcgggtcggcgttgggcgctcaggtcgtgcgt
gacgccgcggagctgccgccggcgatggtcgggtgcctcgcctacggcgacaccgtgctg
gccgagcagttcatctccggtgtcgaggtggcggtcgcggtcgtcgacgggccggacggt
cccacggcgctgcccgccgtcgagatcgttccggagaccggggtctacgactacacggct
cgctacacggcggggctgaccgacttccacgcgccggctcggctggacgcggcggcggcc
aaggcggtgggggagctcgcggtggcggcgcaccggttgctcgggctgcgggacgtgtcg
aggaccgacgcggtcgtggccgaggacgggacggtctacttcctcgaagtgaacgtgtcg
ccggggctgaccgagacgtcgctcctgccgatggccgtcgaggcggcggggcagtcgctg
ggcgagatctacgccggtttgatcgagcgtgccgtcgctcgttga

DBGET integrated database retrieval system