KEGG   Lentzea guizhouensis: BBK82_15945Help
Entry
BBK82_15945       CDS       T04448                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
led  Lentzea guizhouensis
Pathway
led00500  Starch and sucrose metabolism
led01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBK82_15945
Enzymes [BR:led01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BBK82_15945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Glucodextran_N
Motif
Other DBs
NCBI-ProteinID: ANZ37329
UniProt: A0A1B2HHX4
LinkDB All DBs
Position
3192792..3194585
Genome map
AA seq 597 aa AA seqDB search
MRILALVVLLLVAVTPVVHAAEVVPLPADKQGFGTARGGSPVWFTLGHQGLSEIFHPDLS
TPATRETRLLVNGKPGQARTEPADDRSLTFRQRLRGDGWHAVLTYVTDPQRAAVLANVEF
WAQRPMKLTIDHVPMKGTSTVESTLPTEPVRHARGTFAVEFGDGVARAALGRDFRAVARE
YARGWHAYLDGLKRPRSADRRLYDMSVMVLAATEDKTNPGASIASPSFPWAFGFDRELAP
ELGPYALVWPRDLYHVSTAMIAAGDRGFAERSLDFMLRVQQQPDGHLPQNTRVDGTPVWL
KVQLDQTAAPLLLAWHLDRRDQSTVDSLRRSADYLLSYPNSPFSEQERWENQSGYSPATI
ASVVAGLVCFADLLQRNGENADRYLAAADAWQRQVEGWTATNTGPYAPKPYYLRVTKDGK
PDQGTKYNLGDNNPTDIDQRAVVDPSFLELVRLGVKRADDPVIRNTVAVVDAQLKEQGYW
HRFTQDGYGETADGRPWGINWPEPTRTYGRLWPLLSGERGEYELLAGDKASAAQRLREIA
ATANSGLMLPEQVWNGRGTQSATPLAWTHAQYVRLAWSLDRGEPVERPAVVVKRYLS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaggattctggcgctcgtcgtgctcctgctcgtcgcggtgactccggtcgtccacgcc
gctgaggtcgtgccactccccgcggacaaacaggggttcggcacggccagagggggcagc
ccggtctggttcacgctcggccaccaggggctgtccgagatcttccaccccgacctgagc
acaccggcgacccgcgagacccggctactggtgaacggcaagccggggcaggcgcggacc
gaacccgccgacgaccggtcgctgacgttccggcaacggttacgcggtgacggctggcac
gccgtgctcacctacgtcaccgatccgcagcgcgcggccgtgctggcgaacgtcgagttc
tgggcccagcggccgatgaagctgacgatcgaccacgtgccgatgaagggcacgagcacc
gtggagagcacgctgcccaccgaacccgtgcggcacgcgcgtggcacgttcgccgtcgag
ttcggtgacggtgtcgcacgcgcggcgctgggtcgcgacttccgtgcggtggcgagggag
tacgcgcggggctggcacgcgtacctggacgggctgaagcggccgcgctcggcggaccgg
cggctctacgacatgtcggtgatggtgctggcggcgaccgaggacaagaccaaccccggt
gcgtcgatcgcgtcgccgagcttcccgtgggcgttcgggttcgaccgggagctggcgccg
gagctcgggccgtacgcactcgtgtggccgcgcgacctctaccacgtgtccacggccatg
atcgccgccggcgaccgcgggttcgccgagcggtcgctggacttcatgctgcgcgtgcag
caacagccggacgggcacctgccgcagaacacgcgggtcgacggcaccccggtgtggctg
aaggtccagctcgaccagaccgcggcaccgctgttgctggcctggcacctcgaccggcgt
gaccagtccactgtggactcgctgcggcgctcggcggactacctgctgagctacccgaac
tcgccgttcagcgagcaggagcggtgggagaaccagagcggctactcgccggccacgatc
gcgtccgtggtcgcgggcctggtgtgcttcgcggacctgttgcagcgcaacggggagaac
gccgaccggtacctcgccgccgcggacgcgtggcagcggcaggtcgagggctggacggcg
acgaacaccggcccgtacgcgcccaagccgtactacctgcgggtcaccaaggacgggaag
ccggaccagggcacgaagtacaacctcggcgacaacaacccgaccgacatcgaccagcgg
gccgtggtcgacccgagcttcctggaactggtgcggctgggcgtgaagcgcgcggacgac
ccggtcatccgcaacaccgtggccgtggtcgacgcccagctgaaggaacagggctactgg
caccggttcacgcaggacggctacggcgagacggccgacggcaggccttggggcatcaac
tggccggagccgacgcgcacgtacggccggttgtggccgttgctgagcggcgaacgcggt
gagtacgagctgctggccggtgacaaggcgagtgccgcccagcggttgcgggagatcgcg
gcgaccgcgaacagcgggctcatgctgcccgaacaggtctggaacggccggggcacgcag
tcggcgaccccgctggcctggacgcacgcgcagtacgtgcggctggcgtggtcgctcgac
cggggcgaaccggtcgagcgacctgccgtggtggtgaagcggtacctcagctga

DBGET integrated database retrieval system