KEGG   Lentzea guizhouensis: BBK82_18410Help
Entry
BBK82_18410       CDS       T04448                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
led  Lentzea guizhouensis
Pathway
led00020  Citrate cycle (TCA cycle)
led00480  Glutathione metabolism
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
led01120  Microbial metabolism in diverse environments
led01130  Biosynthesis of antibiotics
led01200  Carbon metabolism
led01210  2-Oxocarboxylic acid metabolism
led01230  Biosynthesis of amino acids
Module
led_M00009  Citrate cycle (TCA cycle, Krebs cycle)
led_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:led00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBK82_18410
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BBK82_18410
Enzymes [BR:led01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BBK82_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANZ37736
UniProt: A0A1B2HJ38
LinkDB All DBs
Position
3664331..3665554
Genome map
AA seq 407 aa AA seqDB search
MGKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVTLEYYDLGIEHRDATDDQVTIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNVPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGAGKLTITFQPEDGSDPIEHVVTEFPAEGGVAM
GMYNYNKSIEDFARASFSYGLQRGYPVYMSTKNTILKAYDGQFKDIFERVFNEEFKAEFD
AKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTRGLMHRGKLDGTPEVIRFAEALE
SVVIETVEAGQMTKDLALLISKDQEWLTTEDFLAALDENLKKKMASF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttcagggcaccgtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtcacccttgag
tactacgacctgggcatcgagcaccgggacgcgaccgacgaccaggtcacgatcgacgcc
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgccggacgag
gcgcgggtcgaggagttcggcctgaagaagatgtgggtctcgccgaacggcacgatccgc
aacatcctcggcggtgtcgtcttccgcgagccgatcatcatctcgaacgtgccgcgcctg
gtcccgggctggacgaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
gccaccaacttcaaggtgcccggcgccggcaagctcacgatcacgttccagccggaggac
ggctcggacccgatcgagcacgtcgtcaccgagttcccggcggagggcggtgtggcgatg
ggcatgtacaactacaacaagtccatcgaggacttcgcccgcgcctcgttctcctacggc
ctgcagcggggctaccccgtctacatgtccacgaagaatacgatcctgaaggcctacgac
ggccagttcaaggacatcttcgagcgcgtgttcaacgaggagttcaaggcggagttcgac
gccaagggcctcacctacgagcaccgcctcatcgacgacatggtcgccgctgccatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtccagtccgacacg
gtcgcgcagggcttcggctcgctcggcctgatgacgtcggtcctgatgacgccggacggc
aagaccgtcgaggccgaggccgcccacggcaccgtgacgcgccacttccgccagcaccag
gccggcaagcccacctccacgaacccgatcgcctcgatcttcgcgtggacccgtggcctg
atgcaccgcggcaagctggacggcacgcctgaggtgatccgcttcgccgaggcgctggag
tcggtcgtcatcgagacggtcgaggccggtcagatgaccaaggacctggccctgctgatc
agcaaggaccaggagtggctgaccaccgaggacttcctcgccgcgctggacgagaacctc
aagaagaagatggcgtcgttctga

DBGET integrated database retrieval system