KEGG   Lentzea guizhouensis: BBK82_19545Help
Entry
BBK82_19545       CDS       T04448                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
led  Lentzea guizhouensis
Brite
KEGG Orthology (KO) [BR:led00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBK82_19545
Enzymes [BR:led01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BBK82_19545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ANZ37925
UniProt: A0A1B2HJM8
LinkDB All DBs
Position
complement(3881312..3881719)
Genome map
AA seq 135 aa AA seqDB search
MRLVSRILRPRVEATAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDPEFRERAVLIK
EQRSELVKHHLWVLWTDYFKPPHFEKYPELHDLFNRATKAAGASGTKGSMDPATGQQLLD
LIAQIDKIFWETKQG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgtgtcgcgcattctccgcccgcgcgtcgaagccaccgcgcactgcgacctg
ccctgcggcgtctacgaccccgcgcaggcccgcatcgaggccgagtcggtcaaggcggtc
caggagaagtaccaggccaacgaggacccggagttccgggagcgcgccgtcctgatcaag
gagcagcgcagcgagctcgtcaagcaccacctgtgggtgctgtggacggactacttcaag
ccgccgcacttcgagaagtaccccgagctgcacgacctcttcaaccgcgccaccaaggcc
gcgggtgcgtcgggcaccaaggggtcgatggacccggcgacggggcagcagctgctggac
ctgatcgcgcagatcgacaagatcttctgggagaccaagcagggctga

DBGET integrated database retrieval system