KEGG   Lentzea guizhouensis: BBK82_27140Help
Entry
BBK82_27140       CDS       T04448                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
led  Lentzea guizhouensis
Pathway
led00250  Alanine, aspartate and glutamate metabolism
led00410  beta-Alanine metabolism
led00640  Propanoate metabolism
led00650  Butanoate metabolism
led01100  Metabolic pathways
led01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BBK82_27140
   00650 Butanoate metabolism
    BBK82_27140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBK82_27140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBK82_27140
Enzymes [BR:led01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BBK82_27140
Amino acid related enzymes [BR:led01007]
 Aminotransferase (transaminase)
  Class III
   BBK82_27140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANZ39201
UniProt: A0A1B2HND0
LinkDB All DBs
Position
5516282..5517565
Genome map
AA seq 427 aa AA seqDB search
MAHKELLARHRAVMPKWLALYYDEPIEIASASGRRVTDAEGTTYLDFFAGILTNAIGYDV
AEISDAIRSQLDTGVLHSSTLYLIKSQVELAEKVAELSGIPDAKVFFTNSGTEANETALM
LATQARRSEQVLALRNSYHGRAFATVAVTGNRGWSASALSPIKVSWVHGGYRYRSPFKGL
NDADYVKACVDDLREIIETTTSGDVACMIVEPIQGVGGFTSPPDGLFRAFKDVLDEYGIL
FVSDEVQTGWGRTGEHFWGIQAHDVVPDAMTFAKGLGNGLAIGGVVARGDLMDTITANSI
STFGGNPVSTAGALATLNYLLDHDLQANAAKLGSRLLGGLRELAEKHPVIGDVRGKGLMV
GVELVGPEGEPNPGAATTVLNEAKAGGLLVGKGGLHGNVIRLAPPMTLTEDELEEALGIL
AQAVSRA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaaggagctgctggcacggcaccgcgcggtgatgccgaagtggctggccctc
tactacgacgagcccatcgagatcgcgagcgcgagcggacgccgcgtgaccgacgccgag
ggcacgacctacctcgacttcttcgcgggcatcctgaccaacgccatcggctacgacgtc
gccgagatcagcgacgcgatccgctcgcagctcgacaccggcgtgctgcacagctcgacg
ctgtacctgatcaagtcgcaggtcgagctggcggagaaggtcgcggaactgagtggcatc
ccggacgccaaggtgttcttcaccaactccggcaccgaggccaacgagaccgcgctcatg
ctcgccacccaggcccgccgcagcgagcaggtgctggcgttgcgcaacagctaccacggc
cgtgcgttcgccacggtcgccgtcaccggcaaccgcggctggtcggcgagtgccctgtcg
ccgatcaaggtcagctgggtgcacggcggctaccgctaccgcagcccgttcaagggactg
aacgacgccgactacgtcaaggcctgcgtcgacgacctgcgcgagatcatcgagaccacc
acgtccggtgacgtcgcgtgcatgatcgtcgagccgatccagggcgtcggcggcttcacc
tcgccgcccgacggcctgttccgcgcgttcaaggacgtgctggacgagtacgggatcctg
ttcgtctccgacgaggtgcagaccggctggggccgcaccggcgagcacttctggggcatc
caggcgcacgacgtcgtgccggacgcgatgacgttcgccaagggcctcggcaacggcctc
gcgatcggcggcgtggtcgcgcgcggcgacctgatggacacgatcaccgccaactcgatc
tccacgttcggcggcaacccggtctccacggccggcgcgctggcgacgctcaactacctg
ctcgaccacgacctgcaggccaacgcggccaagctcggctcgcggctgctcggcggcctg
cgcgagctcgccgagaagcacccggtgatcggtgacgtgcgcggcaagggcctgatggtc
ggcgtcgagctggtcggacccgagggcgagcccaaccccggcgcggccacgaccgtgctc
aacgaggccaaggcgggcggtctgctcgtcggcaagggcggtctccacggcaacgtgatc
aggctggctccgccgatgaccctgaccgaggacgagctggaagaggcactcggcatcctc
gcccaggcggtgtcgcgagcatga

DBGET integrated database retrieval system