KEGG   Lentzea guizhouensis: BBK82_36775Help
Entry
BBK82_36775       CDS       T04448                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
led  Lentzea guizhouensis
Pathway
led03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:led00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BBK82_36775
Enzymes [BR:led01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BBK82_36775
DNA repair and recombination proteins [BR:led03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BBK82_36775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RHH_1
Motif
Other DBs
NCBI-ProteinID: ANZ40726
UniProt: A0A1B2HSK8
LinkDB All DBs
Position
complement(7657879..7659321)
Genome map
AA seq 480 aa AA seqDB search
MAGLDEYRRKRDPGRTPEPVPDAAALPRGDDDTFVIQEHHASSLHWDVRLERGGVLVSWA
VPKGLPPTTDVVRLAVHTEDHPLEYAEFSGEIPKGEYGGGSMFIWDHGRYETVKWSDREV
DVVLRGGRVEGQFVFFRSGEDGKNWMVKRRHANARPDWQVLPEQVKPMLAVPGPLPADDD
DQWAYEFKWDGVRAILRVEGGRVQAWSRLGNDITVAYPELQAVGEQLGSTEALLDGEIVA
LRDGRPSFSALQNRMHVSKSDAARRAARQYPITLLLFDLLHLDGTSLLQLPFVKRRELLR
GLELKGPTWLTPPSYDTDGAAVLAASREQGLEGVVAKRVDSVYQPGMRSPVWRKITDLMA
QEVVIGGWRMGEGKRAGVIGALLLGIPRGDGLAFAGSVGTGFNDAELAVLTPRLKALARR
SSPFVTEMPRERSRGAKWVEPELVAEVVFRQWTPDGRMRFPAWRGLRPDKSPEEVRRVEQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctcgacgagtaccggcgcaagcgggatccgggcaggacgccggagcccgtg
cctgatgccgccgcgcttccgcggggcgacgatgacacgttcgtgattcaggagcaccac
gcgtcgagcctgcattgggatgtgcggttggagcggggtggtgtgctggtgtcgtgggcg
gtgccgaaggggttgccgccgacgacggatgtggtgcggctggcggtgcacaccgaggat
cacccgttggagtacgcggagttctcgggtgagattccgaagggtgagtacggcggcggg
tcgatgttcatctgggaccacggccgttatgagacggtgaagtggtctgaccgtgaggtc
gacgtggtcttgcgcgggggtcgggtcgaggggcagttcgtgttcttccgttcgggtgag
gacgggaagaactggatggtgaagcgccggcatgcgaatgcgcggccggactggcaggtg
cttcccgagcaggtgaagccgatgctggcggtgccgggtcccctgccggccgatgatgac
gaccagtgggcgtatgagttcaagtgggatggtgtccgggcgatcctgcgggtcgagggt
ggccgggtgcaggcgtggtcgcggttgggcaacgacatcacggtggcgtatccggagctg
caggcggtgggtgagcagctggggtcgacggaggcgttgctcgacggtgagatcgtggcg
ttgcgggacgggcggccgagtttcagcgcgttgcagaaccggatgcacgtgagcaagtcg
gatgcggcgcggcgggcggctcgtcagtacccgatcacgttgttgctgttcgacctgttg
caccttgatggcacgtccttgttgcagcttcctttcgtgaagcgccgggagttgctccgg
gggttggagctgaagggcccgacgtggctcactcccccgtcgtatgacaccgatggtgcc
gcggtgctggcggcgagtcgtgagcaggggcttgagggtgtggtggcgaagcgggtggac
tcggtgtaccagccggggatgcggtcgccggtgtggcgcaagatcaccgatttgatggcg
caggaggtggtgatcgggggctggcggatgggtgaaggcaagcgtgcgggggtgatcggc
gcgttgttgctgggtattccgcggggtgacgggctggcgttcgcggggtcggtgggcacg
gggttcaacgatgcggagctggcggtgctgacgccgcggttgaaggcgttggcgcgcagg
tcgtcgccgttcgtgacggagatgccgcgggagcggtcgaggggcgcgaagtgggtcgag
ccggagctggtggccgaggtggtgttccggcagtggacgccggacgggcggatgcggttt
ccggcgtggcgtggtttgcggccggacaagtcgcctgaggaggtgcgccgggttgagcag
tga

DBGET integrated database retrieval system