KEGG   Lentzea guizhouensis: BBK82_37155
Entry
BBK82_37155       CDS       T04448                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
led  Lentzea guizhouensis
Pathway
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BBK82_37155
Enzymes [BR:led01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     BBK82_37155
SSDB
Motif
Pfam: DeoC NMO AP_endonuc_2
Other DBs
NCBI-ProteinID: ANZ40788
UniProt: A0A1B2HSW4
LinkDB
Position
7724394..7725182
AA seq 262 aa
MNQPQSFGAKLRLDRIDRNGDGRLMIVPLDHSVADGPVTSDDSLEDLVGELAAAKVDAVV
LHKGTARHLNPKLFVDTSLIVHLNASTSHAPDPDAKYLVTSVEAALRLGADAVSVHVNMG
SQQEAEQVADLARTAEETERWGMPLLAMMYARGPQIDNSADPELVRHSATLAADLGADIV
KVSYPGSASAMADVVRACPIPVVVAGGPPVDDKRELLQRVAASVRAGAAGVAMGRNIFQH
PTPGRLAREIGDVVHGRMAIAA
NT seq 789 nt   +upstreamnt  +downstreamnt
gtgaaccagccgcaatccttcggcgcgaagctgcgcctggaccgcatcgaccgcaacggc
gacggccggttgatgatcgtcccgctcgaccactccgtcgccgacggaccggtgacgtcc
gacgactccctggaggacctggtcggcgagctcgccgcggccaaggtcgacgcggtggtg
ctgcacaagggcaccgcacgccacctcaaccccaagctgttcgtcgacacctcgctgatc
gtgcacctgaacgcgagcacctcccacgcccccgacccggacgccaagtacctcgtcacg
agcgtcgaggcggcgctgcggctcggtgcggacgcggtgagcgtgcacgtgaacatgggc
tcgcagcaggaggccgagcaggtcgccgacctggcgcgcaccgcggaggagaccgagcgg
tggggcatgccgttgctggcgatgatgtacgcccgcggcccgcagatcgacaactccgcc
gatcccgagctggtcaggcactccgcgacgctcgcggccgacctcggcgcggacatcgtg
aaggtcagctaccccggctcggcgagcgcgatggccgacgtcgtgcgcgcctgcccgatc
ccggtggtggtcgccggcggcccgccggtggacgacaagcgcgagctgctgcagcgcgtc
gccgcctcggtgcgcgcgggcgcggccggggtggccatgggccgcaacatcttccaacat
ccgacgcccggccggctggccagggagatcggtgacgtcgtgcacggtcgcatggcgatc
gccgcctga

DBGET integrated database retrieval system