KEGG   Lentzea guizhouensis: BBK82_38140Help
Entry
BBK82_38140       CDS       T04448                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
led  Lentzea guizhouensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANZ40945
UniProt: A0A1B2HTD4
LinkDB All DBs
Position
7945643..7947088
Genome map
AA seq 481 aa AA seqDB search
MPLEQKTFFIGGEWVLPSSPDRVTVSSASTEEVLGTSPLGREADMDAAVAAARRAFDDPC
GWSTWAPTDRAAVLRRLADALDARADELTRLISSENGMPLTLSRGLEGAVPSMLLRYYAD
LACSVPVEERRDGLLGRPAVVRREPVGVVAAITPWNAPQTLASGKYAPALAAGATVVLKP
SPETALDAVLFAEAVADAGVPDGVVNVVPAGREVGAYLVAHPGVDKVAFTGSSSAGRAIA
ETCGRLLRPVTLELGGKSAAIVLEDADLDSKAVQQEFVAATLLNNGQACFASTRILAPRS
RYAEVVEAVSALAASLTVGDPLDLDTHVGPLVSEQQRDRVEGYIAKGRAEGSRVTVGGGR
PAHLDRGWYVEPTVFADVDNRQVIAQEEIFGPVLVITPYDDELQAVRLANDSQFGLAGSV
WTRDAEHGLEIARRVRTGSFGVNRYMTDPIAPFGGVKASGIGRELGPEGLAGYQDLKSVY
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctagagcagaagacgttcttcatcggcggtgagtgggtcctgcccagctcgcct
gaccgcgtcaccgtgtccagcgccagcactgaggaggttctcggcacctcgccgctcggc
cgggaggccgacatggacgccgccgtcgcggccgcgcggcgcgcgttcgacgacccgtgc
gggtggtcgacgtgggcgcccacggatcgggcggcggtgctgcgccgactcgccgacgcg
ctcgacgcccgcgccgatgagctcacgcgactgatcagcagcgagaacggcatgccgctg
accctctcgcggggtctggagggcgcggtgcccagcatgctgctgcgctactacgccgac
ctcgcctgcagcgtcccggtggaggagcgccgcgacgggttgctcggccgcccggcggtg
gtgcggcgcgagccggtcggcgtggtcgccgcgatcaccccgtggaacgccccgcagacg
ttggcgtcgggcaagtacgcgccggcgctcgcggccggcgcgacggtggtgctgaagccc
tcaccggagaccgcgctcgacgcggtgctgttcgccgaggcagtcgccgatgccggggtt
ccggacggtgtcgtcaacgtcgttcctgcggggcgcgaggtaggcgcatatctggtggcg
caccccggcgtcgacaaggtggccttcaccggctccagctcggccggccgcgcgatcgcc
gagacgtgcggacgcctgctgcggccggtcaccctcgagctcggcgggaagtccgcggcc
atcgtgctcgaggacgccgatctcgactccaaggcggtgcagcaggagttcgtcgccgcg
acgttgctgaacaacggccaggcgtgcttcgccagcacgcggatcctcgcgccgcgcagc
cgctacgccgaggtcgtcgaggcggtgtcggcgctcgcagcctcgctgaccgtcggcgac
cccctcgacctcgacacccacgtcggtcccctggtcagcgaacagcaacgcgaccgcgtg
gagggctacatcgccaagggccgggccgaaggctcgcgggtgaccgtggggggcggccga
cccgcgcacctcgaccgcggctggtacgtggagcccaccgtcttcgcggacgtggacaac
aggcaggtgatcgctcaggaggagatcttcggcccggtgctcgtcatcaccccttacgac
gacgagctgcaagccgtccgcctggccaacgactcccagttcggcctcgccgggtcagtg
tggacccgcgacgccgagcacggcctcgagatcgcccgccgggtccggaccggctcgttc
ggcgtcaaccggtacatgaccgatccgatcgcgccgttcggcggggtcaaggccagtggc
atcggccgggaactcggacccgagggccttgccggctaccaggacctcaagtccgtctac
ctctga

DBGET integrated database retrieval system