KEGG   Lentzea guizhouensis: BBK82_46855Help
Entry
BBK82_46855       CDS       T04448                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
led  Lentzea guizhouensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C FANC_SAP
Motif
Other DBs
NCBI-ProteinID: ANZ43616
UniProt: A0A1B2I0X9
LinkDB All DBs
Position
9877778..9878827
Genome map
AA seq 349 aa AA seqDB search
MPPVKPMLAKSVPELPRGDGLHYEPKWDGFRCIVFRDGDEIELGSRNDKPLTRYFPEVVE
LLRDALPPRCVVDGEIVLVTPDGLSFDVLQLRLHPAASRVRKLAVETPASFVAFDLLALG
DEDVTGLTLAQRRGMLEEAVREVPGVYLTPSTTDPGVAQDWFTRFEGAGFDGVMVKAADG
VYEPDKRVMWKVKHERTADCVVAGYRLHKDGETVGSLVLGLHQDGELRNVGVASSFTAAR
RRELVEELKPLLNPAEHPWSAWATYEGPGMNSRWNPSKQLQVVLLEPTRVAEVRYEHVQG
GRFRHTARLVRFREDKTAAECTYEQLEEVPPAELDALFGEAERRRTIEP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctccggtgaagccgatgctcgccaagtccgtgcccgagctgccgcgcggggacggg
ctgcactacgagccgaagtgggacggcttccgctgcatcgtgttccgcgacggcgacgag
atcgagctcggctcccgcaacgacaagccgctgacccgctacttccccgaggtcgtcgag
ctgctgcgcgacgcgctgccgccgcggtgcgtggtcgacggcgagatcgtgctggtcaca
ccggacgggctgagcttcgacgtgctgcagctgcggctgcacccggcggcctcgcgggtg
cgcaagctcgccgtcgagaccccggcgagcttcgtggcgttcgacctgctggccctcggc
gacgaggacgtgaccgggctgacgctggcgcagcggcgcgggatgctcgaggaggccgtc
cgcgaggtccccggcgtgtacctgacaccgtccacgacggatcccggcgtggcgcaggac
tggttcacccggttcgagggcgccgggttcgacggcgtgatggtcaaggcggccgacggc
gtctacgagcccgacaagcgcgtgatgtggaaggtgaagcacgagcgcacggccgactgc
gtggtggcgggctacaggttgcacaaggacggcgagacggtcggctccctcgtgctcggc
ctccaccaggacggcgagctgcgcaacgtgggcgtcgccagcagcttcaccgccgcccgc
cgccgggagctggtcgaggagctgaagccgctgctgaacccggccgagcacccgtggagc
gcgtgggcgacgtacgagggtcccggtatgaacagccggtggaacccgtcgaagcagttg
caggtcgtgttgttggagccgacccgtgtggctgaggtgcgttatgagcacgtgcagggc
ggacggttccgccacaccgcacggctcgttcggttccgtgaggacaaaacagccgctgag
tgcacctacgagcagctggaggaagtgccgccggccgagctggacgccctgttcggcgag
gccgagaggcgcaggacaatcgaaccgtga

DBGET integrated database retrieval system